Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-AP005111HU |
| Product Type | FC Receptor |
| Size |
$104Purchase it in Cusabio online store (Shop online in the US. Customers outside the US, please order from local distributors.) |
| Uniprot No. | P08637 |
| Image |
|
| Storage Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2 |
| Alias | Low Affinity Immunoglobulin Gamma Fc Region Receptor III-A; CD16a Antigen; Fc-Gamma RIII-Alpha; Fc-Gamma RIII; Fc-gamma RIIIa; FcRIII; FcRIIIa; FcR-10; IgG Fc Receptor III-2; CD16a; FCGR3A; CD16A; FCG3; FCGR3; IGFR3 |
| Species | Homo sapiens (Human) |
| Biological_Activity | The ED50 as determined by its ability to bind Human IGHG1 in functional ELISA is less than 20 ug/ml. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Sequence | GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQ |
| Research Area | Immunology |
| Source | Mammalian cell |
| Gene Names | FCGR3A |
| Expression Region | 17-208aa |
| Tag Info | C-terminal 6xHis-tagged |
| Mol. Weight | 22.61 kDa |
| Protein Description | Extracellular Domain |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis. |
| Involvement in disease | Immunodeficiency 20 (IMD20) |
| Subcellular Location | Cell membrane, Single-pass type I membrane protein, Secreted |
| Tissue Specificity | Expressed on natural killer cells, macrophages, subpopulation of T-cells, immature thymocytes and placental trophoblasts. |
| Database Links |
HGNC: 3619 OMIM: 146740 KEGG: hsa:2214 STRING: 9606.ENSP00000356946 UniGene: Hs.372679 |
| Pathway |
Fc gamma R-mediated phagocytosis
Natural killer cell mediated cytotoxicity Osteoclast differentiation |
FCGR3A Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA008543LC01HU | FCGR3A Antibody, FITC conjugated | Human | ELISA |
| CSB-PA287660 | FCGR3A Antibody | Human | ELISA,IHC |
| CSB-PA183080 | FCGR3A Antibody | Human | ELISA,IHC |
| CSB-PA008543LD01HU | FCGR3A Antibody, Biotin conjugated | Human | ELISA |
| CSB-PA008543LB01HU | FCGR3A Antibody, HRP conjugated | Human | ELISA |
FCGR3A Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA008543LA01HU | FCGR3A Antibody | Human | ELISA, IHC, IF |
FCGR3A Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-CF008543HU | Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A(FCGR3A) | in vitro E.coli expression system |
| CSB-YP008543HU1 CSB-EP008543HU1 CSB-BP008543HU1 CSB-MP008543HU1 |
Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A(FCGR3A),partial | Yeast E.coli Baculovirus Mammalian cell |
FCGR3A ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-EL008543HU | Human Low affinity immunoglobulin gamma Fc region receptor III-A(FCGR3A) ELISA kit | serum, plasma, tissue homogenates | 11.75 pg/mL |
Recombinant Mouse ATP synthase subunit beta, mitochondrial(Atp5f1b),partial
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Nicotinamide N-methyltransferase(NNMT)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Aldo-keto reductase family 1 member C3(AKR1C3)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Immunity-related GTPase family M protein(IRGM)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Uncharacterized protein C21orf2(C21orf2)
Express system: E.coli
Species: Homo sapiens (Human)
