CD47|Proteinase K|EGFR|BCMA|PD-L1|CD276|ACE2|TMPRSS2|Exosome Isolation Kits
Code | CSB-AP005111HU |
Size |
US$3267Purchase it in Cusabio online store (only available for customers from the US) |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
Activity | The ED50 as determined by its ability to bind Human IGHG1 in functional ELISA is less than 20 ug/ml. |
Target Names | FCGR3A |
Uniprot No. | P08637 |
Research Area | Immunology |
Alternative Names | CD 16; CD 16a; CD16; CD16a; CD16a antigen; CD16B; CD16b antigen; Fc fragment of IgG; Fc fragment of IgG low affinity IIIa receptor (CD16); Fc fragment of IgG low affinity IIIa receptor; Fc fragment of IgG receptor IIIa; Fc fragment of IgG; low affinity III; receptor (CD16); Fc fragment of IgG; low affinity III; receptor for (CD16); Fc fragment of IgG; low affinity IIIa; receptor (CD16); Fc fragment of IgG; low affinity IIIa; receptor (CD16a); Fc fragment of IgG; low affinity IIIa; receptor for; Fc fragment of IgG; low affinity IIIb; receptor (CD16b); Fc fragment of IgG; low affinity IIIb; receptor for (CD16); Fc gamma R3; Fc gamma receptor III 2 (CD 16); Fc gamma receptor III A; Fc gamma receptor IIIA; Fc gamma receptor IIIb (CD 16); Fc gamma RIII alpha; Fc gamma RIII; Fc gamma RIII beta; Fc gamma RIIIa; Fc gamma RIIIb; Fc of IgG; Fc-gamma receptor III2 (CD 16); Fc-gamma receptor III2 (CD16); Fc-gamma receptor IIIb (CD16); Fc-gamma RIII; Fc-gamma RIII-alpha; Fc-gamma RIIIa; FCG 3; FCG3; FCG3A_HUMAN; FCgammaRIIIA; FCGR 3; FCGR 3A; FCGR3; FCGR3A; FCGR3A protein; FCGRIII; FCGRIII-2; FcR 10; FcR-10; FcR10; FcRIII; FcRIIIa; IGFR 3; IGFR3; IgG Fc receptor III 1; IgG Fc receptor III 2; IgG Fc receptor III-2; IMD20; immunoglobulin G Fc receptor III; immunoglobulin G Fc receptor III-2; Low affinity IIIa receptor; Low affinity immunoglobulin gamma Fc region receptor III A; Low affinity immunoglobulin gamma Fc region receptor III-A; Low affinity immunoglobulin gamma Fc region receptor IIIB; neutrophil-specific antigen NA |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 17-208aa |
Complete Sequence | GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQ |
Mol. Weight | 22.61 kDa |
Protein Length | Extracellular Domain |
Tag Info |
C-terminal 6xHis-tagged |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>
Function | Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis. |
Gene References into Functions |
|
Involvement in disease | Immunodeficiency 20 (IMD20) |
Subcellular Location | Cell membrane, Single-pass type I membrane protein, Secreted |
Tissue Specificity | Expressed on natural killer cells, macrophages, subpopulation of T-cells, immature thymocytes and placental trophoblasts. |
Database Links |
HGNC: 3619 OMIM: 146740 KEGG: hsa:2214 STRING: 9606.ENSP00000356946 UniGene: Hs.372679 |
Tel: 301-363-4651
Email: support@cusabio.com
Distributors Worldwide