Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A(FCGR3A),partial

In Stock
Code CSB-AP005111HU
See More Details
Product Type FC Receptor
Size $104Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P08637
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2
Alias Low Affinity Immunoglobulin Gamma Fc Region Receptor III-A; CD16a Antigen; Fc-Gamma RIII-Alpha; Fc-Gamma RIII; Fc-gamma RIIIa; FcRIII; FcRIIIa; FcR-10; IgG Fc Receptor III-2; CD16a; FCGR3A; CD16A; FCG3; FCGR3; IGFR3
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to bind Human IGHG1 in functional ELISA is less than 20 ug/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQ
Research Area Immunology
Source Mammalian cell
Gene Names FCGR3A
Expression Region 17-208aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 22.61 kDa
Protein Description Extracellular Domain
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.
Involvement in disease Immunodeficiency 20 (IMD20)
Subcellular Location Cell membrane, Single-pass type I membrane protein, Secreted
Tissue Specificity Expressed on natural killer cells, macrophages, subpopulation of T-cells, immature thymocytes and placental trophoblasts.
Database Links

HGNC: 3619

OMIM: 146740

KEGG: hsa:2214

STRING: 9606.ENSP00000356946

UniGene: Hs.372679

Pathway Fc gamma R-mediated phagocytosis
Natural killer cell mediated cytotoxicity
Osteoclast differentiation

Related Products

FCGR3A Antibodies

FCGR3A Antibodies for Homo sapiens (Human)

FCGR3A Antibodies for Human

FCGR3A Proteins

FCGR3A Proteins for Homo sapiens (Human)

FCGR3A ELISA Kit

FCGR3A ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.