Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A), partial (Active)

In Stock
Code CSB-AP005111HU
Abbreviation Recombinant Human FCGR3A protein, partial (Active)
MSDS
Size $154
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
Loaded Human IgG1 Fc on Protein-A Biosensor, can bind Human CD16a-His (V176) with an affinity constant of 0.571 uM as determined in BLI assay.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
FCGR3A; CD16A; FCG3; FCGR3; IGFR3; Low affinity immunoglobulin gamma Fc region receptor III-A; CD16a antigen; Fc-gamma RIII-alpha; Fc-gamma RIII; Fc-gamma RIIIa; FcRIII; FcRIIIa; FcR-10; IgG Fc receptor III-2; CD antigen CD16a
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
17-208aa
Complete Sequence
GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQ
Mol. Weight
22.61 kDa
Protein Length
Extracellular Domain
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered 20mM PB, 150mM NaCl, pH 7.4.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A) is produced in mammalian cells, which appears to help ensure proper folding and post-translational modifications. The extracellular domain spans amino acids 17-208 and comes with a C-terminal 6xHis tag for purification. This protein achieves purity levels above 95% when analyzed by SDS-PAGE. Endotoxin levels stay below 1.0 EU/µg. The protein shows biological activity by binding human CD16a-His (V176) with a 0.571 µM affinity constant in BLI assays.

FCGR3A, which researchers also call CD16a, acts as a receptor for the Fc region of immunoglobulin G (IgG). It plays what seems to be a critical role in antibody-dependent cellular cytotoxicity (ADCC). Natural killer (NK) cells express this receptor primarily, though macrophages and some T-cell subsets also show expression. The receptor appears crucial for mediating immune responses. Understanding how FCGR3A works and interacts with other molecules may prove important for research into immunological pathways and therapeutic antibody development.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. IgG-Fc Receptor Binding Affinity Studies

This recombinant FCGR3A extracellular domain could work as a standardized tool for studying binding interactions between various IgG subclasses and CD16a. Surface plasmon resonance or bio-layer interferometry assays might benefit from such standardization. The binding affinity to human IgG1 Fc (0.571 μM) offers a reference point for comparing other immunoglobulin variants or engineered antibodies. Scientists can examine how changes to antibody Fc regions alter CD16a binding kinetics and thermodynamics. High purity and low endotoxin levels make the protein suitable for quantitative biophysical measurements that demand consistent protein quality.

2. Antibody-Dependent Cellular Cytotoxicity (ADCC) Mechanism Research

Scientists might use the recombinant CD16a extracellular domain in cell-free biochemical assays to study ADCC initiation without dealing with complex whole-cell systems. Different therapeutic antibodies or antibody-drug conjugates can be tested for their interaction with this Fc receptor. The His-tag allows for immobilization in pull-down experiments or ELISA-based binding studies. Mammalian expression likely ensures proper glycosylation patterns that could influence binding specificity and affinity measurements. This approach allows controlled analysis of the antibody-receptor interaction that happens before NK cell activation in ADCC responses.

3. Fc Receptor Competitive Binding Assays

The C-terminal His-tagged FCGR3A appears useful for developing competitive binding assays. These could screen libraries of antibody variants or small molecule inhibitors that affect Fc-FcγR interactions. The established binding affinity gives researchers a baseline for measuring competitive displacement by test compounds in microplate-based or biosensor formats. Scientists can attach the protein through the His-tag and measure how different molecules compete with IgG1 Fc for binding sites. Such assays may help researchers understand what structural features are needed for Fc receptor engagement and identify compounds that change immune complex formation.

4. Structural Biology and Protein-Protein Interaction Studies

This soluble FCGR3A extracellular domain looks promising for structural studies aimed at understanding CD16a-antibody complexes. X-ray crystallography or cryo-electron microscopy could provide insights. The high purity and defined expression region (17-208aa) give researchers a uniform protein sample that might work well for crystallization trials with various IgG Fc fragments. The His-tag helps with protein purification and can orient the protein properly in atomic force microscopy or single-molecule studies. Co-crystallization experiments with different antibody Fc variants could reveal the molecular details that determine binding specificity and affinity differences.

5. Fc Engineering and Antibody Optimization Research

The recombinant protein appears valuable for testing engineered antibodies with modified Fc regions designed to enhance or reduce CD16a binding. Scientists developing new therapeutic antibodies can use this standardized FCGR3A preparation to check how specific amino acid changes in the Fc domain affect receptor binding through systematic kinetic analysis. The consistent biological activity and mammalian glycosylation pattern suggest that binding measurements reflect interactions that actually occur in the body. This application seems particularly useful for antibody engineering projects focused on improving effector functions or creating antibodies with reduced immunogenicity.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*