Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A), partial (Active)

In Stock
Code CSB-AP005111HU
Abbreviation Recombinant Human FCGR3A protein, partial (Active)
MSDS
Size $154
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
Loaded Human IgG1 Fc on Protein-A Biosensor, can bind Human CD16a-His (V176) with an affinity constant of 0.571 uM as determined in BLI assay.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
FCGR3A; CD16A; FCG3; FCGR3; IGFR3; Low affinity immunoglobulin gamma Fc region receptor III-A; CD16a antigen; Fc-gamma RIII-alpha; Fc-gamma RIII; Fc-gamma RIIIa; FcRIII; FcRIIIa; FcR-10; IgG Fc receptor III-2; CD antigen CD16a
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
17-208aa
Complete Sequence
GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQ
Mol. Weight
22.61 kDa
Protein Length
Extracellular Domain
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered 20mM PB, 150mM NaCl, pH 7.4.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A) is produced in mammalian cells, which appears to help ensure proper folding and post-translational modifications. The extracellular domain spans amino acids 17-208 and comes with a C-terminal 6xHis tag for purification. This protein achieves purity levels above 95% when analyzed by SDS-PAGE. Endotoxin levels stay below 1.0 EU/µg. The protein shows biological activity by binding human CD16a-His (V176) with a 0.571 µM affinity constant in BLI assays.

FCGR3A, which researchers also call CD16a, acts as a receptor for the Fc region of immunoglobulin G (IgG). It plays what seems to be a critical role in antibody-dependent cellular cytotoxicity (ADCC). Natural killer (NK) cells express this receptor primarily, though macrophages and some T-cell subsets also show expression. The receptor appears crucial for mediating immune responses. Understanding how FCGR3A works and interacts with other molecules may prove important for research into immunological pathways and therapeutic antibody development.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. IgG-Fc Receptor Binding Affinity Studies

This recombinant FCGR3A extracellular domain is confirmed to bind IgG1 Fc with an affinity of 0.571 μM and is suitable for studying interactions with various IgG subclasses. However, the low affinity (micromolar range) may require sensitive detection methods in binding assays. The mammalian expression ensures proper glycosylation for authentic interactions, but researchers should validate that the C-terminal His-tag does not sterically hinder binding in specific assay formats, such as SPR or BLI.

2. Antibody-Dependent Cellular Cytotoxicity (ADCC) Mechanism Research

The protein is appropriate for studying the initial binding step in ADCC, such as antibody-receptor interactions, but it cannot model full ADCC responses that require cellular signaling via transmembrane and intracellular domains. Researchers can use it in cell-free assays to screen antibodies for Fc binding, but results should be validated in cellular assays with full-length FCGR3A expressed on NK cells.

3. Fc Receptor Competitive Binding Assays

This protein is suitable for competitive binding assays to screen antibody variants or inhibitors. The His-tag facilitates immobilization, and the measured affinity provides a baseline. However, the soluble extracellular domain may exhibit different binding kinetics compared to membrane-bound FCGR3A, and hits should be validated in cellular contexts to ensure physiological relevance.

4. Structural Biology and Protein-Protein Interaction Studies

The extracellular domain is valuable for structural studies, but the C-terminal His-tag may need removal for crystallization to avoid interference. Mammalian glycosylation ensures native-like structure but may complicate crystallization; researchers might consider deglycosylation or tag cleavage. The protein can be used for co-crystallization with IgG Fc to study binding interfaces.

5. Fc Engineering and Antibody Optimization Research

This recombinant FCGR3A is well-suited for Fc engineering studies, providing a standardized, glycosylated domain for testing antibody binding affinity. The known affinity allows comparison of engineered antibodies. However, researchers should validate binding improvements in cellular assays with full-length receptor to confirm enhanced ADCC potential.

Final Recommendation & Action Plan

This mammalian-expressed human FCGR3A extracellular domain with C-terminal His-tag is a validated tool for in vitro Fc binding studies, demonstrating specific interaction with IgG1 Fc at 0.571 μM affinity. Prioritize its use in binding kinetics, competitive assays, and antibody screening, but acknowledge that the soluble domain may not fully replicate membrane-bound receptor behavior. For structural work, consider tag removal to avoid crystallization artifacts. When studying ADCC mechanisms, use this protein for initial binding steps, but complement with cellular models for full validation. Always include controls for tag-related effects and validate key findings in physiological systems expressing full-length FCGR3A. The high purity and low endotoxin support reliable results, but the low affinity requires sensitive detection methods.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*