Recombinant Human Fibroblast growth factor 1(FGF1)

In Stock
Code CSB-AP003761HU
Product Type Growth Factor
Size $65Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P05230
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm Filtered 20 mM Tris, 400 mM NaCl, 1 mM DTT, pH 8.0
Alias Fibroblast Growth Factor 1; FGF-1; Acidic Fibroblast Growth Factor; aFGF; Endothelial Cell Growth Factor; ECGFHeparin-Binding Growth Factor 1; HBGF-1; FGF1; FGFA
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 5 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Research Area Signal Transduction
Source E.coli
Gene Names FGF1
Expression Region 16-155aa
Tag Info Tag-Free
Mol. Weight 15.9 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of heparin leading to FGFR1 dimerization and activation via sequential autophosphorylation on tyrosine residues which act as docking sites for interacting proteins, leading to the activation of several signaling cascades. Binds to integrin ITGAV
Subcellular Location Secreted, Cytoplasm, Cytoplasm, cell cortex, Cytoplasm, cytosol, Nucleus
Protein Families Heparin-binding growth factors family
Tissue Specificity Predominantly expressed in kidney and brain. Detected at much lower levels in heart and skeletal muscle.
Database Links

HGNC: 3665

OMIM: 131220

KEGG: hsa:2246

STRING: 9606.ENSP00000338548

UniGene: Hs.483635

Pathway Hippo signaling pathway
MAPK signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Ras signaling pathway
Rap1 signaling pathway

Related Products

FGF1 Antibodies

FGF1 Antibodies for Homo sapiens (Human)

FGF1 Antibodies for Human

FGF1 Proteins

FGF1 Proteins for Homo sapiens (Human)

FGF1 ELISA Kit

FGF1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.