Recombinant Human Fibroblast growth factor 9(FGF9)

In Stock
Code CSB-AP003811HU
Product Type Growth Factor
Size US$153
Uniprot No. P31371
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 5% Trehalos, pH 7.4
Alias Fibroblast Growth Factor 9; FGF-9; Glia-Activating Factor; GAF; Heparin-Binding Growth Factor 9; HBGF-9; FGF9
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is less than 5 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Research Area Signal Transduction
Source E.coli
Gene Names FGF9
Expression Region 1-208aa
Tag Info Tag-Free
Mol. Weight 23.44 kDa
Protein Description Full Length
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. May have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors.
Involvement in disease Multiple synostoses syndrome 3 (SYNS3)
Subcellular Location Secreted
Protein Families Heparin-binding growth factors family
Tissue Specificity Glial cells.
Database Links

HGNC: 3687

OMIM: 600921

KEGG: hsa:2254

STRING: 9606.ENSP00000371790

UniGene: Hs.111

Pathway MAPK signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Ras signaling pathway
Rap1 signaling pathway

Related Products

FGF9 Antibodies

FGF9 Antibodies for Human

FGF9 Antibodies for Homo sapiens (Human)

FGF9 Proteins

FGF9 Proteins for Homo sapiens (Human)

FGF9 ELISA Kit

FGF9 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.