Recombinant Human CD160 antigen(CD160)

In Stock
Code CSB-AP005221HU
Product Type Immune Checkpoint
Size US$65
Uniprot No. O95971
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Alias CD160 Antigen; Natural Killer Cell Receptor BY55; CD160; BY55
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to bind Mouse TNFRSF14 in functional ELISA is less than 50 ug/ml.
Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLS
Research Area Immunology
Source Mammalian cell
Gene Names CD160
Expression Region 27-159aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 15.8 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor showing broad specificity for both classical and non-classical MHC class I molecules.
Subcellular Location Cell membrane, Lipid-anchor, GPI-anchor
Tissue Specificity Expressed in spleen, peripheral blood, and small intestine. Expression is restricted to functional NK and T cytotoxic lymphocytes.
Database Links

HGNC: 17013

OMIM: 604463

KEGG: hsa:11126

STRING: 9606.ENSP00000235933

UniGene: Hs.488237

Related Products

CD160 Antibodies

CD160 Antibodies for Homo sapiens (Human)

CD160 Proteins

CD160 Proteins for Homo sapiens (Human)

CD160 Proteins for Mus musculus (Mouse)

CD160 ELISA Kit

CD160 ELISA Kit for Homo sapiens (Human)

CD160 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.