Recombinant Mouse Hepatitis A virus cellular receptor 2 homolog(Havcr2),partial


In Stock
Code CSB-AP005341MO
See More Details
Product Type Immune Checkpoint
Size $98Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. Q8VIM0
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Alias Hepatitis A virus cellular receptor 2 homolog; HAVcr-2; T-cell immunoglobulin and mucin domain-containing protein 3; T-cell immunoglobulin mucin receptor 3; T-cell membrane protein 3; Tim3; Timd3
Species Mus musculus (Mouse)
Biological_Activity The ED50 as determined by its ability to bind Human Galectin 9 in functional ELISA is less than 20 ug/ml.
Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence RSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIR
Research Area Immunology
Source Mammalian cell
Gene Names Havcr2
Expression Region 20-191aa
Tag Info C-terminal FC-tagged
Mol. Weight 46.3 kDa
Protein Description Extracellular Domain
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cell surface receptor implicated in modulating innate and adaptive immune responses. Generally accepted to have an inhibiting function. Reports on stimulating functions suggest that the activity may be influenced by the cellular context and/or the respective ligand
Subcellular Location Isoform 1: Membrane, Single-pass type I membrane protein, Cell junction
Protein Families Immunoglobulin superfamily, TIM family
Tissue Specificity Expressed in T-helper type 1 lymphocytes. Not expressed by naive T-cells but up-regulated as they differentiate into T-helper-1 cells. Also expressed by differentiated type 1 CD8+ cytotoxic T-cells. Expressed on peritoneal exudate macrophages, monocytes,
Database Links

KEGG: mmu:171285

STRING: 10090.ENSMUSP00000020668

UniGene: Mm.72168

Related Products

Havcr2 Proteins

Havcr2 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.