Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-AP005341MO |
| Product Type | Immune Checkpoint |
| Size |
$98Purchase it in Cusabio online store (Shop online in the US. Customers outside the US, please order from local distributors.) |
| Uniprot No. | Q8VIM0 |
| Image |
|
| Storage Buffer | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Alias | Hepatitis A virus cellular receptor 2 homolog; HAVcr-2; T-cell immunoglobulin and mucin domain-containing protein 3; T-cell immunoglobulin mucin receptor 3; T-cell membrane protein 3; Tim3; Timd3 |
| Species | Mus musculus (Mouse) |
| Biological_Activity | The ED50 as determined by its ability to bind Human Galectin 9 in functional ELISA is less than 20 ug/ml. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Sequence | RSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIR |
| Research Area | Immunology |
| Source | Mammalian cell |
| Gene Names | Havcr2 |
| Expression Region | 20-191aa |
| Tag Info | C-terminal FC-tagged |
| Mol. Weight | 46.3 kDa |
| Protein Description | Extracellular Domain |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Cell surface receptor implicated in modulating innate and adaptive immune responses. Generally accepted to have an inhibiting function. Reports on stimulating functions suggest that the activity may be influenced by the cellular context and/or the respective ligand |
| Subcellular Location | Isoform 1: Membrane, Single-pass type I membrane protein, Cell junction |
| Protein Families | Immunoglobulin superfamily, TIM family |
| Tissue Specificity | Expressed in T-helper type 1 lymphocytes. Not expressed by naive T-cells but up-regulated as they differentiate into T-helper-1 cells. Also expressed by differentiated type 1 CD8+ cytotoxic T-cells. Expressed on peritoneal exudate macrophages, monocytes, |
| Database Links |
KEGG: mmu:171285 STRING: 10090.ENSMUSP00000020668 UniGene: Mm.72168 |
Havcr2 Proteins for Mus musculus (Mouse)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP840881MO CSB-EP840881MO CSB-BP840881MO CSB-MP840881MO |
Recombinant Mouse Hepatitis A virus cellular receptor 2 homolog(Havcr2),partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Mouse Homeobox protein Nkx-3.2(Nkx3-2)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Pan troglodytes Lymphotoxin-beta(LTB),partial
Express system: E.coli
Species: Pan troglodytes (Chimpanzee)
Recombinant Human IgG receptor FcRn large subunit p51(FCGRT),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Nuclear cap-binding protein subunit 2(NCBP2)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Protein disulfide-isomerase(P4HB)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Plasma kallikrein(KLKB1),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Bovine Keratin, type I cytoskeletal 17(KRT17)
Express system: E.coli
Species: Bos taurus (Bovine)
