Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-AP005341MO |
| See More Details |  |
| Product Type | Immune Checkpoint |
| Size |
$98Purchase it in Cusabio online store (only available for customers from the US) |
| Uniprot No. | Q8VIM0 |
| Image |
|
| Storage Buffer | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Alias | Hepatitis A virus cellular receptor 2 homolog; HAVcr-2; T-cell immunoglobulin and mucin domain-containing protein 3; T-cell immunoglobulin mucin receptor 3; T-cell membrane protein 3; Tim3; Timd3 |
| Species | Mus musculus (Mouse) |
| Biological_Activity | The ED50 as determined by its ability to bind Human Galectin 9 in functional ELISA is less than 20 ug/ml. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Sequence | RSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIR |
| Research Area | Immunology |
| Source | Mammalian cell |
| Gene Names | Havcr2 |
| Expression Region | 20-191aa |
| Tag Info | C-terminal FC-tagged |
| Mol. Weight | 46.3 kDa |
| Protein Description | Extracellular Domain |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Cell surface receptor implicated in modulating innate and adaptive immune responses. Generally accepted to have an inhibiting function. Reports on stimulating functions suggest that the activity may be influenced by the cellular context and/or the respective ligand |
| Subcellular Location | Isoform 1: Membrane, Single-pass type I membrane protein, Cell junction |
| Protein Families | Immunoglobulin superfamily, TIM family |
| Tissue Specificity | Expressed in T-helper type 1 lymphocytes. Not expressed by naive T-cells but up-regulated as they differentiate into T-helper-1 cells. Also expressed by differentiated type 1 CD8+ cytotoxic T-cells. Expressed on peritoneal exudate macrophages, monocytes, |
| Database Links |
KEGG: mmu:171285 STRING: 10090.ENSMUSP00000020668 UniGene: Mm.72168 |
Havcr2 Proteins for Mus musculus (Mouse)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP840881MO CSB-EP840881MO CSB-BP840881MO CSB-MP840881MO |
Recombinant Mouse Hepatitis A virus cellular receptor 2 homolog(Havcr2),partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Human Elongation factor Tu, mitochondrial(TUFM)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Heat shock protein HSP 90-beta(HSP90AB1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rat Kinesin-like protein KIF1C(Kif1c)
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Drimia maritima Ribosome-inactivating protein charybdin
Express system: E.coli
Species: Drimia maritima (Sea squill) (Charybdis maritima)
Recombinant Clostridium botulinum Botulinum neurotoxin type B(botB),partial
Express system: Yeast
Species: Clostridium botulinum
Wait!
Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now!
We don't deal in spam.
