Recombinant Mouse Interleukin-33 (Il33), partial (Active)

In Stock
Code CSB-AP004251MO
Abbreviation Recombinant Mouse Il33 protein, partial (Active)
MSDS
Size $204
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 0.01 EU/µg as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse IL-33 at 5μg/ml can bind Mouse ST2-Fc, the ED50 of Mouse ST2-Fc is 0.33 ug/ml.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Interleukin 33; IL-33; IL33; C9orf26; NKHEV; Interleukin-1 family member 11; DVS27; NF-HEV and IL- 1F11
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
109-266aa
Complete Sequence
SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
Mol. Weight
17.6 kDa
Protein Length
Partial
Tag Info
Tag-Free
Form
Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered PBS, 1mM DTT, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Interleukin-33 (Il33) is produced in an E.coli system, representing a partial protein sequence from amino acids 109 to 266. This tag-free protein exhibits a high purity level of over 95%, as confirmed by SDS-PAGE analysis. It demonstrates biological activity, verified through functional ELISA, showing specific binding to Mouse ST2-Fc with an ED50 of 0.33 µg/ml. The endotoxin level is controlled, measuring less than 1.0 EU/µg according to the LAL method.

Interleukin-33 (IL-33) is a cytokine involved in immune system signaling. It acts as an alarmin—basically a molecular distress signal released when cells are damaged. This protein appears to play a critical role in inflammatory and immune responses. IL-33 binds to the receptor ST2, which then activates pathways that influence how immune cells function. Its significance in research is underscored by its involvement in various immune-related processes, potentially offering insights into inflammation mechanisms and therapeutic targets.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. IL-33/ST2 Receptor Binding Studies

This recombinant mouse IL-33 protein can be used to investigate how IL-33 and its receptor ST2 interact in laboratory settings. The confirmed biological activity, demonstrated through ST2-Fc binding with an ED50 of 0.33 μg/ml, provides a solid foundation for dose-response studies. Researchers might apply this protein in surface plasmon resonance (SPR) or bio-layer interferometry (BLI) experiments to determine detailed binding parameters. These studies appear essential for understanding the molecular mechanisms of IL-33 signaling pathways in mouse models.

2. Functional ELISA Development and Optimization

The protein's demonstrated binding capability in functional ELISA makes it suitable for developing standardized IL-33 detection assays. Researchers can use this recombinant protein as a positive control or standard when studying IL-33 levels in mouse tissue samples or cell culture supernatants. The high purity (>95%) and low endotoxin levels likely ensure reliable and reproducible results in quantitative assays. This application may be particularly valuable for preclinical studies investigating inflammatory responses or tissue damage models.

3. Anti-IL-33 Antibody Development and Validation

This biologically active recombinant mouse IL-33 can serve as an immunogen or screening antigen for generating and validating anti-IL-33 antibodies. The protein's confirmed receptor binding activity suggests that generated antibodies will recognize the functionally relevant form of IL-33. Scientists can use this protein in immunization protocols, antibody screening assays, and specificity testing. The tag-free nature of the protein eliminates potential cross-reactivity issues with purification tags during antibody development.

4. Cell-Based Functional Assays

The biologically active IL-33 protein can be applied in cell culture experiments to study IL-33-mediated cellular responses in mouse cell lines expressing ST2 receptors. Researchers might investigate downstream signaling pathways, cytokine production, or cellular activation using this protein as a stimulus. The low endotoxin level (<1.0 EU/μg) makes it suitable for sensitive cell-based assays where bacterial contamination could interfere with results. Such studies are crucial for understanding IL-33 biology in controlled laboratory environments.

5. Competitive Binding and Inhibition Studies

This recombinant IL-33 can be applied in competitive binding assays to screen for potential IL-33 antagonists or to study how mutations affect receptor binding. The established ED50 value provides a reference point for comparing the binding efficiency of modified IL-33 variants or testing whether small molecules can inhibit binding. Researchers can design competition experiments where this protein serves as the reference ligand against which other compounds are tested for their ability to disrupt IL-33/ST2 interactions.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Involved in the maturation of Th2 cells inducing the secretion of T-helper type 2-associated cytokines. Also involved in activation of mast cells, basophils, eosinophils and natural killer cells. Acts as a chemoattractant for Th2 cells, and may function as an 'alarmin', that amplifies immune responses during tissue injury.; In quiescent endothelia the uncleaved form is constitutively and abundantly expressed, and acts as a chromatin-associated nuclear factor with transcriptional repressor properties, it may sequester nuclear NF-kappaB/RELA, lowering expression of its targets. This form is rapidely lost upon angiogenic or proinflammatory activation.
Gene References into Functions
  1. Il33 -/- mice exhibited reduced anxiety-like behaviors in the elevated plus maze and the open field test, as well as deficits in social novelty recognition, despite their intact sociability, in the three-chamber social interaction test. The immunoreactivity of c-Fos proteins, an indicator of neuronal activity, was altered in several brain regions implicated in anxiety-related behaviors. PMID: 29379874
  2. this paper shows that IL-33 promotes gastrointestinal allergy in a TSLP-independent manner PMID: 28656964
  3. our findings demonstrate the critical roles of interleukin 33 in promoting colorectal cancer development through inducing tumor-infiltrating ST2L+ regulatory T cells PMID: 29950152
  4. Combined blockade of the IL-13 and IL-33 pathways leads to a greater inhibition of type 2 inflammation over inhibition of either pathway alone. PMID: 27697499
  5. Taken together, our data provide the evidence that ST2 deficiency in early phase of sepsis downregulates myeloid precursors, inflammatory NK and dendritic cells PMID: 30001716
  6. data indicate that during acute, resolving colitis, IL-33/ST2 plays a crucial role in gut mucosal healing by inducing epithelial-derived miR-320 that promotes epithelial repair/restitution and the resolution of inflammation. PMID: 30224451
  7. IL-33 may down-regulate CLDN1 expression through the ERK/STAT3 pathway in keratinocytes. PMID: 29534857
  8. the release of IL-33 and GM-CSF from epithelial cells induces the activation of p65 and the p38-MK2/3 signaling module in Dendritic Cells, resulting in Th2 polarization and, finally, allergic inflammation. PMID: 29288203
  9. Injection of IL-21-expressing or IL-33-expressing plasmids facilitates clearance of pre-established genotype B strain designated BPS (BPS) persistence and protects cured mice from BPS re-challenge. PMID: 29242561
  10. In a model of sepsis, IL-33 treatment enhanced the IFN-gamma level in blood and promoted mice's survival, so the protective effects of IL-33 depend on IFN-gamma. The IL-33 treatment also promoted both gammadelta T cells and NK cells in septic mice. PMID: 29610934
  11. VHL-HIF-glycolysis axis is essential for the late-stage maturation and function of ILC2s via targeting IL-33-ST2 pathway. PMID: 29452935
  12. results therefore demonstrate that manipulation of the IL33-NLRP3 axis may be an effective therapy to suppress neuroinflammation and improve the efficacy of antimalarial drug treatment of cerebral malaria. PMID: 29954866
  13. Deficiency of IL-33 was associated with exacerbated atopic dermatitis -like inflammation in Stat6VT mice suggesting at least some aspect(s) of IL-33 signaling could negatively regulate disease in this model. PMID: 29368135
  14. this study shows novel protective mechanism for interleukin-33 at the mucosal barrier during influenza-associated bacterial superinfection PMID: 28401938
  15. IL-33 acts directly on bone marrow ILC2s, making them an early source of IL-5 and part of a process that is central in IL-33-driven eosinophilia. PMID: 28921511
  16. Blockage of IL-33/ST2 axis reduces APAP-mediated organ injury by dampening liver chemokine release and activation of resident and infiltrating liver non-parenchymal cells. PMID: 29032512
  17. these data provide mechanistic insight into how FAK controls the tumor immune environment, namely, through a transcriptional regulatory network mediated by nuclear IL-33. PMID: 29208683
  18. Thymic stromal lymphopoietin and IL-33 promote skin inflammation and vaccinia virus replication in a mouse model of atopic dermatitis. PMID: 26830114
  19. Results show that interleukin-33 acts to express Schaffer collateral/CA1 long term potentiation (LTP) relevant to spatial learning and memory in a myeloid differentiation factor 88 (MyD88)-dependent manner. PMID: 29147584
  20. IL-33 may induce Th17 cell responses via IL-1beta and IL-6 derived from IL-33-matured dendritic cells. PMID: 28802996
  21. Metaplasia induction and macrophage polarisation after parietal cell loss is coordinated through a cytokine signalling network of IL-33 and IL-13, linking a combined response to injury by both intrinsic mucosal mechanisms and infiltrating M2 macrophages. PMID: 28196875
  22. IL-33/ST2 can induce production of proinflammatory cytokines, such as TNF-alpha and IL-6, through production of IL-13 in Plasmodium chabaudi-infected BALB/c mice, suggesting that IL-33/ST2 play a critical role in inflammatory responses to malaria infection. PMID: 28359899
  23. these results provide new insights into the mechanisms by which intestinal epithelial cells , via IL-33/ST2 axis, may control pro-inflammatory TH17 cells in the small intestine to sustain homeostasis PMID: 28198366
  24. In cells pre-treated with IL-4 and IL-13, expression of mRNA for Ccl3, Ccl5, Ccl17, Ccl24, and Il1b in response to IL-33 stimulation was significantly increased. This was paralleled by up-regulated expression of miR-155-5p, a miRNA that is predicted to regulate several aspects of allergic inflammation. IL-33-activated macrophages may contribute to the exaggerated airway inflammation in exacerbations of allergic asthma. PMID: 29621782
  25. Mice treated with HW for 4 weeks demonstrated a significant decrease in the AD severity score compared with PW-treated mice (p less than 0.01). Hydrogen water administration also significantly reduced TEWL and serum TARC levels (p less than 0.01), infiltration of mast cells (p less than 0.05), and secretion of the proinflammatory cytokines interleukin (IL)-1beta and IL-33 (p less than 0.05) in skin lesions compared wit... PMID: 28889151
  26. IL-33 is necessary for activating Th2-type natural helper cells following respiratory syncytial virus-induced airway inflammation PMID: 28771101
  27. Study found that interleukin33 was critical for repair of aged neurons. Its deficiency caused tau abnormality and late-onset of neurodegeneration in the cerebral cortex and hippocampus, accompanied with Alzheimer's disease-like cognition and memory impairment. PMID: 28675392
  28. this study finds that IL-33 signals primarily to microglia under physiologic conditions, that it promotes microglial synapse engulfment, and that it can drive microglial-dependent synapse depletion in vivo. PMID: 29420261
  29. IL-33 cooperated with Kras and TGFbetaR2 mutations in the development of extrahepatic cholangiocarcinoma (ECC), and anti-IL-33 treatment suppressed ECC development significantly. PMID: 28439013
  30. Data provide clear evidence that IL-33 plays a protective role in trinitrobenzenesulfonic acid-induced colitis, which is closely related to alternatively activated macrophages polarization. PMID: 28423665
  31. Results show that IL-33 is significantly increased in the inflamed skin in urushiol-induced allergic contact dermatitis mice because of increased production and release from keratinocytes. PMID: 27821781
  32. IL-33 production induced by P. gingivalis fimbriae and lipopeptide is recognized by TLR2 and may modulate dendritic cel function in periodontal diseases. PMID: 28637954
  33. CLOCK temporally gates mast cell responses to IL-33 via regulation of ST2 expression. Our findings provide novel insights into IL-33/mast cell-associated physiology and pathologies. PMID: 28259547
  34. results suggest that alveolar Gq/11 signaling maintains alveolar homeostasis and likely independently increases TGFbeta activation in response to the mechanical stress of the epithelium and decreases epithelial IL-33 synthesis. Together, these findings suggest that disruption of Gq/11 signaling promotes inflammatory emphysema but protects against mechanically induced lung injury. PMID: 27811142
  35. Our data indicate that CB2 may directly contribute to the pathogenesis of eosinophil-driven diseases. Moreover, we provide new insights into the molecular mechanisms underlying the CB2 -mediated priming of eosinophils. PMID: 26864308
  36. IL-33 dysregulated lung Treg cells and impaired immunologic tolerance to inhaled antigens PMID: 28196763
  37. gut pericryptal fibroblasts release IL-33 to translate bacterial infection into an epithelial response to promote antimicrobial defense. PMID: 27184849
  38. Mex-3B facilitates the development of allergic airway inflammation by directly upregulating IL-33 expression via inhibiting miR-487b-3p mediated repression of IL-33. PMID: 27545879
  39. IL-33 promoted the new extracellular matrix deposition and angiogenesis formation, which indicates an important role of IL-33 on matrix synthesis and neovascularization. PMID: 28697404
  40. Data indicate that interleukin-33 (IL-33)-induced Interleukin-13 (IL-13) production by type-2 helper T cells (Th2 cells) Is dependent on epidermal growth factor receptor (EGFR) expression. PMID: 29045902
  41. Heligmosomoides polygyrus Alarmin Release Inhibitor (HpARI) prevents binding of active interleukin-33 (IL-33) to the IL-33 receptor. PMID: 29045903
  42. Despite its expression in the synovium of arthritic mice and normal keratinocytes, IL-33 is not required for collagen-induced arthritis development in arthritis or psoriasis PMID: 27317338
  43. The studies establish chronic pancreatitis as an IL-33-dependent inflammation resulting from synergistic interactions between the NOD1 and CCKR signaling pathways. PMID: 26813347
  44. study concludes that IL-33 and TSLP are required for epithelial cell IL-25 expression, mucous metaplasia, and ILC2 expansion following early-life rhinovirus infection PMID: 28701507
  45. Bone marrow-derived mast cells cultured in TGF-beta1, beta2, or beta3 showed reduced IL-33-mediated production of TNF, IL-6, IL-13, and MCP-1 in a concentration-dependent manner. TGF-beta1 inhibited IL-33-mediated Akt and ERK phosphorylation as well as NF-kappaB- and AP-1-mediated transcription. PMID: 28637902
  46. results suggest that EGF is a key growth factor that increased IL-33 production and ST2 receptor expression during intestinal inflammation and carcinogenesis; the EGF/IL-33/ST2 axis represents a novel therapeutic target in colon cancer PMID: 27300306
  47. Lactic Acid Suppresses IL-33-Mediated Mast Cell Inflammatory Responses via Hypoxia-Inducible Factor-1alpha-Dependent miR-155 Suppression PMID: 27559047
  48. Liver Treg cells show a high expression of ST2, a cellular receptor for tissue alarmin IL-33, which is strongly upregulated in the liver of infected mice. These results illustrate the importance of IL-33 in the suppressive function of liver Treg cells during Cytomegaloviruses (CMVs) infection. PMID: 28448566
  49. These data suggest that plasmacytoid dendritic cells producing IFN-alpha and IL-33 play a pivotal role in the chronic fibro-inflammatory responses underlying murine autoimmune pancreatitis and human IgG4-related autoimmune pancreatitis. PMID: 28373582
  50. In vitro IL-33 treatment abrogated MHV-3 and IFN-gamma induced FGL2 expression in RAW264.7 and THP-1 cells. PMID: 28494352

Show More

Hide All

Subcellular Location
Nucleus.; Nucleus. Chromosome. Cytoplasm. Cytoplasmic vesicle, secretory vesicle. Secreted.
Protein Families
IL-1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*