Recombinant Mouse Interleukin-33(Il33),partial (Active)

In Stock
Code CSB-AP004251MO
Product Type Interferon
Size $137Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. Q8BVZ5
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Alias Interleukin 33; IL-33; IL33; C9orf26; NKHEV; Interleukin-1 family member 11; DVS27; NF-HEV and IL- 1F11
Species Mus musculus (Mouse)
Biological_Activity The activity is as determined by its binding ability in a functional ELISA. Immobilized recombinant mouse IL33 at 5 μg/mL can bind mouse IL1RL1 with a linear range of 0.625-5ug/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
Research Area Immunology
Source E.coli
Gene Names Il33
Expression Region 109-266aa
Tag Info Tag-Free
Mol. Weight 17.6 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Involved in the maturation of Th2 cells inducing the secretion of T-helper type 2-associated cytokines. Also involved in activation of mast cells, basophils, eosinophils and natural killer cells. Acts as a chemoattractant for Th2 cells, and may function as an "alarmin", that amplifies immune responses during tissue injury.; FUNCTION
Subcellular Location Nucleus, Chromosome, Cytoplasmic vesicle, secretory vesicle, Secreted
Protein Families IL-1 family
Database Links

KEGG: mmu:77125

STRING: 10090.ENSMUSP00000025724

UniGene: Mm.182359

Pathway Necroptosis

Related Products

Il33 Proteins

Il33 Proteins for Mus musculus (Mouse)

Il33 ELISA Kit

Il33 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.