Recombinant Mouse Interleukin-33(Il33),partial (Active)

In Stock
Code CSB-AP004251MO
Size US$3267Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The activity is as determined by its binding ability in a functional ELISA. Immobilized recombinant mouse IL33 at 5 μg/mL can bind mouse IL1RL1 with a linear range of 0.625-5ug/ml.
Target Names Il33
Uniprot No. Q8BVZ5
Research Area Immunology
Alternative Names Interleukin 33; IL-33; IL33; C9orf26; NKHEV; Interleukin-1 family member 11; DVS27; NF-HEV and IL- 1F11
Species Mus musculus (Mouse)
Source E.coli
Expression Region 109-266aa
Complete Sequence SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
Mol. Weight 17.6 kDa
Protein Length Partial
Tag Info Tag-Free
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Involved in the maturation of Th2 cells inducing the secretion of T-helper type 2-associated cytokines. Also involved in activation of mast cells, basophils, eosinophils and natural killer cells. Acts as a chemoattractant for Th2 cells, and may function as an "alarmin", that amplifies immune responses during tissue injury.; FUNCTION
Gene References into Functions
  1. Il33 -/- mice exhibited reduced anxiety-like behaviors in the elevated plus maze and the open field test, as well as deficits in social novelty recognition, despite their intact sociability, in the three-chamber social interaction test. The immunoreactivity of c-Fos proteins, an indicator of neuronal activity, was altered in several brain regions implicated in anxiety-related behaviors. PMID: 29379874
  2. this paper shows that IL-33 promotes gastrointestinal allergy in a TSLP-independent manner PMID: 28656964
  3. our findings demonstrate the critical roles of interleukin 33 in promoting colorectal cancer development through inducing tumor-infiltrating ST2L+ regulatory T cells PMID: 29950152
  4. Combined blockade of the IL-13 and IL-33 pathways leads to a greater inhibition of type 2 inflammation over inhibition of either pathway alone. PMID: 27697499
  5. Taken together, our data provide the evidence that ST2 deficiency in early phase of sepsis downregulates myeloid precursors, inflammatory NK and dendritic cells PMID: 30001716
  6. data indicate that during acute, resolving colitis, IL-33/ST2 plays a crucial role in gut mucosal healing by inducing epithelial-derived miR-320 that promotes epithelial repair/restitution and the resolution of inflammation. PMID: 30224451
  7. IL-33 may down-regulate CLDN1 expression through the ERK/STAT3 pathway in keratinocytes. PMID: 29534857
  8. the release of IL-33 and GM-CSF from epithelial cells induces the activation of p65 and the p38-MK2/3 signaling module in Dendritic Cells, resulting in Th2 polarization and, finally, allergic inflammation. PMID: 29288203
  9. Injection of IL-21-expressing or IL-33-expressing plasmids facilitates clearance of pre-established genotype B strain designated BPS (BPS) persistence and protects cured mice from BPS re-challenge. PMID: 29242561
  10. In a model of sepsis, IL-33 treatment enhanced the IFN-gamma level in blood and promoted mice's survival, so the protective effects of IL-33 depend on IFN-gamma. The IL-33 treatment also promoted both gammadelta T cells and NK cells in septic mice. PMID: 29610934
  11. VHL-HIF-glycolysis axis is essential for the late-stage maturation and function of ILC2s via targeting IL-33-ST2 pathway. PMID: 29452935
  12. results therefore demonstrate that manipulation of the IL33-NLRP3 axis may be an effective therapy to suppress neuroinflammation and improve the efficacy of antimalarial drug treatment of cerebral malaria. PMID: 29954866
  13. Deficiency of IL-33 was associated with exacerbated atopic dermatitis -like inflammation in Stat6VT mice suggesting at least some aspect(s) of IL-33 signaling could negatively regulate disease in this model. PMID: 29368135
  14. this study shows novel protective mechanism for interleukin-33 at the mucosal barrier during influenza-associated bacterial superinfection PMID: 28401938
  15. IL-33 acts directly on bone marrow ILC2s, making them an early source of IL-5 and part of a process that is central in IL-33-driven eosinophilia. PMID: 28921511
  16. Blockage of IL-33/ST2 axis reduces APAP-mediated organ injury by dampening liver chemokine release and activation of resident and infiltrating liver non-parenchymal cells. PMID: 29032512
  17. these data provide mechanistic insight into how FAK controls the tumor immune environment, namely, through a transcriptional regulatory network mediated by nuclear IL-33. PMID: 29208683
  18. Thymic stromal lymphopoietin and IL-33 promote skin inflammation and vaccinia virus replication in a mouse model of atopic dermatitis. PMID: 26830114
  19. Results show that interleukin-33 acts to express Schaffer collateral/CA1 long term potentiation (LTP) relevant to spatial learning and memory in a myeloid differentiation factor 88 (MyD88)-dependent manner. PMID: 29147584
  20. IL-33 may induce Th17 cell responses via IL-1beta and IL-6 derived from IL-33-matured dendritic cells. PMID: 28802996
  21. Metaplasia induction and macrophage polarisation after parietal cell loss is coordinated through a cytokine signalling network of IL-33 and IL-13, linking a combined response to injury by both intrinsic mucosal mechanisms and infiltrating M2 macrophages. PMID: 28196875
  22. IL-33/ST2 can induce production of proinflammatory cytokines, such as TNF-alpha and IL-6, through production of IL-13 in Plasmodium chabaudi-infected BALB/c mice, suggesting that IL-33/ST2 play a critical role in inflammatory responses to malaria infection. PMID: 28359899
  23. these results provide new insights into the mechanisms by which intestinal epithelial cells , via IL-33/ST2 axis, may control pro-inflammatory TH17 cells in the small intestine to sustain homeostasis PMID: 28198366
  24. In cells pre-treated with IL-4 and IL-13, expression of mRNA for Ccl3, Ccl5, Ccl17, Ccl24, and Il1b in response to IL-33 stimulation was significantly increased. This was paralleled by up-regulated expression of miR-155-5p, a miRNA that is predicted to regulate several aspects of allergic inflammation. IL-33-activated macrophages may contribute to the exaggerated airway inflammation in exacerbations of allergic asthma. PMID: 29621782
  25. Mice treated with HW for 4 weeks demonstrated a significant decrease in the AD severity score compared with PW-treated mice (p less than 0.01). Hydrogen water administration also significantly reduced TEWL and serum TARC levels (p less than 0.01), infiltration of mast cells (p less than 0.05), and secretion of the proinflammatory cytokines interleukin (IL)-1beta and IL-33 (p less than 0.05) in skin lesions compared wit... PMID: 28889151
  26. IL-33 is necessary for activating Th2-type natural helper cells following respiratory syncytial virus-induced airway inflammation PMID: 28771101
  27. Study found that interleukin33 was critical for repair of aged neurons. Its deficiency caused tau abnormality and late-onset of neurodegeneration in the cerebral cortex and hippocampus, accompanied with Alzheimer's disease-like cognition and memory impairment. PMID: 28675392
  28. this study finds that IL-33 signals primarily to microglia under physiologic conditions, that it promotes microglial synapse engulfment, and that it can drive microglial-dependent synapse depletion in vivo. PMID: 29420261
  29. IL-33 cooperated with Kras and TGFbetaR2 mutations in the development of extrahepatic cholangiocarcinoma (ECC), and anti-IL-33 treatment suppressed ECC development significantly. PMID: 28439013
  30. Data provide clear evidence that IL-33 plays a protective role in trinitrobenzenesulfonic acid-induced colitis, which is closely related to alternatively activated macrophages polarization. PMID: 28423665
  31. Results show that IL-33 is significantly increased in the inflamed skin in urushiol-induced allergic contact dermatitis mice because of increased production and release from keratinocytes. PMID: 27821781
  32. IL-33 production induced by P. gingivalis fimbriae and lipopeptide is recognized by TLR2 and may modulate dendritic cel function in periodontal diseases. PMID: 28637954
  33. CLOCK temporally gates mast cell responses to IL-33 via regulation of ST2 expression. Our findings provide novel insights into IL-33/mast cell-associated physiology and pathologies. PMID: 28259547
  34. results suggest that alveolar Gq/11 signaling maintains alveolar homeostasis and likely independently increases TGFbeta activation in response to the mechanical stress of the epithelium and decreases epithelial IL-33 synthesis. Together, these findings suggest that disruption of Gq/11 signaling promotes inflammatory emphysema but protects against mechanically induced lung injury. PMID: 27811142
  35. Our data indicate that CB2 may directly contribute to the pathogenesis of eosinophil-driven diseases. Moreover, we provide new insights into the molecular mechanisms underlying the CB2 -mediated priming of eosinophils. PMID: 26864308
  36. IL-33 dysregulated lung Treg cells and impaired immunologic tolerance to inhaled antigens PMID: 28196763
  37. gut pericryptal fibroblasts release IL-33 to translate bacterial infection into an epithelial response to promote antimicrobial defense. PMID: 27184849
  38. Mex-3B facilitates the development of allergic airway inflammation by directly upregulating IL-33 expression via inhibiting miR-487b-3p mediated repression of IL-33. PMID: 27545879
  39. IL-33 promoted the new extracellular matrix deposition and angiogenesis formation, which indicates an important role of IL-33 on matrix synthesis and neovascularization. PMID: 28697404
  40. Data indicate that interleukin-33 (IL-33)-induced Interleukin-13 (IL-13) production by type-2 helper T cells (Th2 cells) Is dependent on epidermal growth factor receptor (EGFR) expression. PMID: 29045902
  41. Heligmosomoides polygyrus Alarmin Release Inhibitor (HpARI) prevents binding of active interleukin-33 (IL-33) to the IL-33 receptor. PMID: 29045903
  42. Despite its expression in the synovium of arthritic mice and normal keratinocytes, IL-33 is not required for collagen-induced arthritis development in arthritis or psoriasis PMID: 27317338
  43. The studies establish chronic pancreatitis as an IL-33-dependent inflammation resulting from synergistic interactions between the NOD1 and CCKR signaling pathways. PMID: 26813347
  44. study concludes that IL-33 and TSLP are required for epithelial cell IL-25 expression, mucous metaplasia, and ILC2 expansion following early-life rhinovirus infection PMID: 28701507
  45. Bone marrow-derived mast cells cultured in TGF-beta1, beta2, or beta3 showed reduced IL-33-mediated production of TNF, IL-6, IL-13, and MCP-1 in a concentration-dependent manner. TGF-beta1 inhibited IL-33-mediated Akt and ERK phosphorylation as well as NF-kappaB- and AP-1-mediated transcription. PMID: 28637902
  46. results suggest that EGF is a key growth factor that increased IL-33 production and ST2 receptor expression during intestinal inflammation and carcinogenesis; the EGF/IL-33/ST2 axis represents a novel therapeutic target in colon cancer PMID: 27300306
  47. Lactic Acid Suppresses IL-33-Mediated Mast Cell Inflammatory Responses via Hypoxia-Inducible Factor-1alpha-Dependent miR-155 Suppression PMID: 27559047
  48. Liver Treg cells show a high expression of ST2, a cellular receptor for tissue alarmin IL-33, which is strongly upregulated in the liver of infected mice. These results illustrate the importance of IL-33 in the suppressive function of liver Treg cells during Cytomegaloviruses (CMVs) infection. PMID: 28448566
  49. These data suggest that plasmacytoid dendritic cells producing IFN-alpha and IL-33 play a pivotal role in the chronic fibro-inflammatory responses underlying murine autoimmune pancreatitis and human IgG4-related autoimmune pancreatitis. PMID: 28373582
  50. In vitro IL-33 treatment abrogated MHV-3 and IFN-gamma induced FGL2 expression in RAW264.7 and THP-1 cells. PMID: 28494352
  51. Incresed expression of IL-33 in colorectal cancer cells enhanced their tumor take, growth, and liver metastasis. PMID: 27120577
  52. IL-33 promoted IgA production from B cells, which is important for maintaining microbial homeostasis in the intestine. PMID: 27775548
  53. these studies establish a basal defect in eosinophilopoiesis in IL-33- and ST2-deficient mice and a mechanism whereby IL-33 supports eosinophils by driving both systemic IL-5 production and the expansion of IL-5Ralpha-expressing precursor cells PMID: 27683753
  54. These results shed light on endogenous IL-33/ST2 signaling as a potential immune regulatory mechanism that serves to promote beneficial microglial responses and mitigate ischemic brain injury after stroke. PMID: 28389473
  55. PIBF1 expression by B cells is induced by the mucosal alarmin IL-33. PMID: 27918564
  56. Type 2 responses are equivalently attenuated in IL-33- and LT-deficient mice, and optimal ILC2 activation reflects potent synergy between these pathways. PMID: 28011865
  57. These findings provide strong support that the immunoregulatory relationship between IL-33 and Tregs can be harnessed therapeutically to prevent GVHD after alloHCT for treatment of malignancy or as a means for tolerance induction in solid organ transplantation. PMID: 27222477
  58. IL-33 receptor-expressing regulatory T cells are highly activated, Th2 biased and suppress CD4 T cell proliferation through IL-10 and TGFbeta release. PMID: 27548066
  59. Plasmodium berghei infection triggered a dramatic increase of IL-33 expression by oligodendrocytes, through ST2 pathway. PMID: 28448579
  60. Results suggest that mechanisms for the protease-dependent sensitization differ between skin and airway and that cooperation of mast cell-dependent, IL-33-independent initial sensitization via skin and protease-induced, IL-33-mediated mechanism in re-exposure via airway to protease allergens maximizes the magnitude of the transition from skin inflammation to asthma in natural history of progression of allergic diseases. PMID: 27001956
  61. Data, including data from studies using knockout mice, suggest that signal transduction via IL33/ST2L (interleukin 33/interleukin-33 receptor) plays a cardioprotective role in myocardial remodeling under mechanical stress (which leads to left ventricular hypertrophy and heart failure). PMID: 28450225
  62. IL-33 is released after mechanical skin injury, enhances IgE-mediated mast cell degranulation, and promotes oral anaphylaxis after epicutaneous sensitization by targeting mast cells. IL-33 neutralization might be useful in treating food-induced anaphylaxis in patients with atopic dermatitis. PMID: 27372570
  63. We demonstrate that allergic sensitization through a disrupted skin barrier promotes development of experimental eosinophilic esophagitis that is critically mediated by the IL-33-ST2 axis and basophils PMID: 27233150
  64. We identified a hitherto unrecognized function of IL-33 as a potent suppressor of innate antiviral immunity and demonstrate that IL-33 contributes significantly to the synergistic interplay between respiratory virus and allergen exposures in the onset and progression of asthma PMID: 27236500
  65. We clearly show that miR-155 has a previously unknown direct regulatory role in the ILC2 subset that affects IL-33 receptor expression, IL-33 responsiveness, and IL-13 production as well as proliferation capability, possibly due to defects in GATA-3 function. PMID: 27492144
  66. in a tape stripping mouse model, IL-33 is dispensable for epicutaneous sensitization but is crucial in the atopic march upon a subsequent airway low-dose encounter with protease allergens PMID: 26987428
  67. Our novel findings suggest that platelets might be important cellular sources of IL-33 protein in vivo and that platelet-derived IL-33 might play a role in airway inflammation PMID: 27056266
  68. IL-33 from monocytes recruited to the lung contributes to house dust mite-induced airway inflammation in a mouse model. PMID: 27310495
  69. IL-33 acts as a potent immune modulator protecting the liver through activation of ST2(+) Treg cells and control of natural killer cells in immune cell-mediated hepatitis. PMID: 27340126
  70. Collectively, the study demonstrated the upregulation of IL-33/ST2 signaling in the obstructed kidney may promote tubular cell injury and interstitial fibrosis PMID: 27067050
  71. this study shows that IL-33 exacerbates mucosal inflammation in the gut of mice with dextran sulfate sodium-induced acute colitis PMID: 28258042
  72. Our findings implicate epithelial DUOX1 as a pivotal mediator of IL-33-dependent activation of innate airway type 2 immune responses to common airborne allergens and indicate that enhanced DUOX1 expression and IL-33 secretion might present important contributing features of allergic asthma. PMID: 26597162
  73. data demonstrate that endogenous PGE2, EP2 receptors, and EPAC are prerequisites for maximal LPS-induced IL-33 expression and that exogenous PGE2 can amplify IL-33 production via EP2 and EP4 receptors. PMID: 28341741
  74. These studies clearly show a crucial role for IL-4 in the induction of airway hyperresponsiveness following Strongyloides venezuelensis infection and for IL-33/ST2 in maintaining airway hyperresponsiveness and lung Th2 responses. PMID: 27102638
  75. this study shows that activation of primed TH2 cells occurs independently of group 2 innate lymphoid cells or their cytokines but that the effector function of both cell types was dependent on combinatorial exposure to IL-33, IL-25 and TSLP PMID: 27749840
  76. IL-33/ST2 pathway plays a role in enhancing inflammation and tissue damage at the site of acute inflammation. PMID: 27222019
  77. these results indicate that nuclear IL-33, but not IL-33 as a cytokine, has beneficial effects on wound healing in mice, probably by suppressing NFkappaB to inhibit excessive inflammation and by maintaining keratinocyte proliferation or migration for epithelialization. PMID: 27839630
  78. this study shows that IL-33 is likely a major factor in acute respiratory distress syndrome, and the release of HMGB1 may be correlated with up-regulation of IL-33 expression PMID: 27318792
  79. the present study hypothesized that IL-33, as a 'master switch' of tissue repair that is secreted from dying or apoptotic cells, activated the IL-33-ST2-MyD88-TRAF6 pathway, amplified Th2-type responses and was involved in the pulmonary fibrosis process, via its receptor ST2, a stable marker of Th2 cells. PMID: 27358001
  80. Ras (G12V)-induced cyclin D1 protein synthesis was markedly suppressed by the knockdown of IL-33. PMID: 27155324
  81. anti-allergic effect of anti-IL-33 antibodies associated with suppression of immunoglobulin free light chain and nitric oxide synthase in a murine model of allergic rhinitis PMID: 26489077
  82. Data suggest that IL-33 and ST2 function as a developmental switch to license thermogenesis during the perinatal period. PMID: 27453471
  83. some SNPs of ST2-IL18R1-IL18RAP gene cluster might increase the risk of susceptibility of Graves' disease (GD) and Hashimoto's thyroiditis (HT) in Chinese Han population. PMID: 26566691
  84. Furthermore, IL-33 injection modulates the innate immune response by polarizing microglia/macrophages toward an antiinflammatory phenotype and reducing the expression of proinflammatory genes, including IL-1beta, IL-6, and NLRP3, in the cortices of APP/PS1 mice. Collectively, our results demonstrate a potential therapeutic role for IL-33 in AD. PMID: 27091974
  85. absence of IL-33 has no negative consequences in normal bone homeostasis while high levels of circulating IL-33 contributes to pathological bone loss. PMID: 26771472
  86. infusion of recombinant protein prevented apoptosis of T lymphocytes and improved survival in a mouse model of sepsis PMID: 26602156
  87. pre-treatment with the ERK1/2 inhibitor U0126 or anti-IL-33 antibody significantly abolished the ovalbumin-induced airway remodeling, increased expressions of IL-33 PMID: 27126934
  88. IL-33 promotes degranulation of bone marrow-derived mast cells and release of cytokines IL-1beta, IL-6 and TNF-alpha. PMID: 27053610
  89. pulmonary interstitial macrophages may not be a source of IL-33 during Respiratory syncytial virus infection PMID: 26603638
  90. demonstrate a pathogenic role for IL-33-mediated eosinophilia and activation of Th2 immunity in chronic intestinal inflammation PMID: 26908008
  91. IL-33 as a novel regulator of neutrophil function in antibacterial infection PMID: 26991049
  92. Our results provide novel insights into the mechanism of action behind alum-induced cytokine responses and show that IL-33 is sufficient to provide a robust secondary antibody response independently of alum. PMID: 26272855
  93. Results demonstrated that IL-33 was released by activated astrocytes actively, and by damaged neurons during experimental autoimmune encephalomyelitis PMID: 26363151
  94. This study indicates a pathogenic role of alarmin IL-33 in a murine model of scrub typhus and highlights infection-triggered endothelial cell damage and IL-33-mediated pathological changes during the course of Orientia infection. PMID: 26943125
  95. IL-33, an alarmin released in response to tissue damage, was secreted from vaginal epithelium after the depletion of commensal microbiota. PMID: 26811463
  96. promotes muscle T reg homeostasis in young mice, and efficient regeneration of injured muscles in aged mice PMID: 26872699
  97. Natural helper cells contribute to pulmonary eosinophilia by producing IL-13 via IL-33/ST2 pathway in a murine model of respiratory syncytial virus infection PMID: 26044350
  98. IL-33 release from cells in the adipose tissue is mediated by the RNase activity of omega1; however, the ability of omega1 to improve metabolic status is reliant upon effective binding of omega1 to CD206. PMID: 26490658
  99. the IL-33/ST2 axis specifically controls visceral adipose tissue-Treg cell development was revealed. PMID: 26277897
  100. targeting these signaling pathways and cells inhibited IL-33-induced TNF-alpha and IL-1beta production in the spinal cord. PMID: 26310268

Show More

Hide All

Subcellular Location Nucleus, Chromosome, Cytoplasmic vesicle, secretory vesicle, Secreted
Protein Families IL-1 family
Database Links

KEGG: mmu:77125

STRING: 10090.ENSMUSP00000025724

UniGene: Mm.182359

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1