Recombinant Human Interleukin-22(IL22),partial (Active)

In Stock
Code CSB-AP004361HU
Product Type Interleukin
Size $195Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. Q9GZX6
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Alias Interleukin-22;IL-22;Cytokine Zcyto18;IL-10-related T-cell-derived-inducible factor;IL-TIF; IL22;ILTIF; ZCYTO18
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to induce IL-10 secretion in COLO?205 human colorectal adenocarcinoma cells is less than 1 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Research Area Immunology
Source E.coli
Gene Names IL22
Expression Region 34-179aa
Tag Info Tag-Free
Mol. Weight 16.9 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytokine that contributes to the inflammatory response in vivo.
Subcellular Location Secreted
Protein Families IL-10 family
Database Links

HGNC: 14900

OMIM: 605330

KEGG: hsa:50616

STRING: 9606.ENSP00000329384

UniGene: Hs.287369

Pathway Jak-STAT signaling pathway
Th17 cell differentiation

Related Products

IL22 Antibodies

IL22 Antibodies for Homo sapiens (Human)

IL22 Antibodies for Human

IL22 Proteins

IL22 Proteins for Homo sapiens (Human)

IL22 ELISA Kit

IL22 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.