Recombinant Human Interleukin-4 receptor subunit alpha(IL4R),partial (Active)

In Stock
Code CSB-AP004281HU
Product Type Interleukin
Size $124Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P24394
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Alias Interleukin-4 receptor subunit alpha; IL-4 receptor subunit alpha; IL-4R subunit alpha; IL-4R-alpha; IL-4RA; CD124; IL-4-binding protein; IL4-BP; IL4R; IL4RA
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to inhibit IL-4-dependent proliferation of TF?1 human erythroleukemic cells is less than 20 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQ
Research Area Immunology
Source Mammalian cell
Gene Names IL4R
Expression Region 26-231aa
Tag Info C-terminal FC-tagged
Mol. Weight 50.2 kDa
Protein Description Extracellular Domain
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2.
Subcellular Location Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Secreted
Protein Families Type I cytokine receptor family, Type 4 subfamily
Tissue Specificity Isoform 1 and isoform 2 are highly expressed in activated T-cells.
Database Links

HGNC: 6015

OMIM: 147781

KEGG: hsa:3566

STRING: 9606.ENSP00000170630

UniGene: Hs.513457

Pathway Jak-STAT signaling pathway
PI3K-Akt signaling pathway
Hematopoietic cell lineage
Th1 and Th2 cell differentiation
Th17 cell differentiation

Related Products

IL4R Antibodies

IL4R Antibodies for Homo sapiens (Human)

IL4R Proteins

IL4R Proteins for Homo sapiens (Human)

IL4R ELISA Kit

IL4R ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.