Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial (Active)

In Stock
Code CSB-AP004281HU
Abbreviation Recombinant Human IL4R protein, partial (Active)
MSDS
Size $184
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
①The ED50 as determined by its ability to inhibit IL-4-dependent proliferation of TF‑1 human erythroleukemic cells is 5-20 ng/ml.②Measured by its binding ability in a functional ELISA. Immobilized Human IL-4 RA-Fc at 5μg/ml can bind Human IL-4 (Biotinylated by NHS-biotin prior to testing), the ED50 of Human IL-4 is 2.43 ng/ml.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
IL4R; IL4RA; 582J2.1; Interleukin-4 receptor subunit alpha; IL-4 receptor subunit alpha; IL-4R subunit alpha; IL-4R-alpha; IL-4RA; CD antigen CD124
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
26-231aa
Complete Sequence
MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQ
Mol. Weight
50.2 kDa
Protein Length
Extracellular Domain
Tag Info
C-terminal hFc-tagged
Form
Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

IL-4Rα is a critical signaling hub in type I and type II IL-4/IL-13 receptor complexes, making its extracellular domain (aa 26–231) an essential tool for dissecting Th2-driven immune pathways. This C-terminal Fc-tagged construct, expressed in mammalian cells to preserve native glycosylation and conformational integrity, demonstrates robust ligand engagement: immobilized IL-4Rα-Fc binds biotinylated human IL-4 with an ED50 of 2.43 ng/mL in functional ELISA, and it inhibits IL-4-dependent proliferation of TF-1 cells with an ED50 of 5–20 ng/mL, confirming biologically relevant blocking activity. These validated activities provide a suitable basis for receptor-ligand interaction assays by ELISA, SPR, or BLI, competitive inhibition studies, blocking antibody screening, and therapeutic antibody epitope mapping. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based neutralization assays and sensitive drug discovery screening campaigns.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2.; Soluble IL4R (sIL4R) inhibits IL4-mediated cell proliferation and IL5 up-regulation by T-cells.
Gene References into Functions
  1. dimerization governed by two-dimensional ligand-receptor interactions with a critical role of the transmembrane domain PMID: 28706306
  2. Interleukin-4 receptor subunit alpha (IL-4Ralpha) haplotypes for Val75Ile, Ser503Pro, and Arg576Gln are associated with measles Immunoglobulin G production in Mozambican children but not Australian children. IL-4Ralpha 503Pro is more prevalent in Mozambique vaccine failure cases compared with controls. PMID: 28594599
  3. We consider that although no association was found among diverse SNPs from human IL-10 and IL-4 promoter regions and gastric cancer event, the present research provides insight into two possible biomarkers of immunological nature (increased level of serum IL-4) and genetic nature (presence of the IL-10, -G1082A SNP) related to this neoplasm in our population. PMID: 30526523
  4. IL4RA and ADAM33 variants may be risk markers of asthma exacerbations in type-2 inflammatory endotype. Precise endotyping may facilitate the identification of genetic risk markers of asthma exacerbations. PMID: 28326636
  5. this study shows that the IL-4Ralpha polymorphism is associated with susceptibility to chronic immune thrombocytopenia PMID: 28511637
  6. Here in this review, we discuss the structural details of IL-4 and IL-4Ralpha subunit and the structural similarities between IL-4 and IL-13. We also describe detailed chemistry of type-I and type-II receptor complexes and their signaling pathways. Furthermore, we elaborate the strength of type-II hetero dimer signals in response to IL-4 and IL-13. PMID: 27165851
  7. Naive CD4+ Tconv cells from subjects with asthma bearing the IL4RR576 mutation show defective induction of iTreg cells and their skewing toward a TH17-like phenotype. PMID: 27479084
  8. Result showed that exposure of Peripheral Blood-Mesenchymal Stem Cells (PB-MSCs) to Noggin was associated with changes in pattern of CD29/CD184 expression. The expression profile of CD29(+/-)/CD184(-) can be suggested as a robust signature for tracing differentiation of PB-MSCs into neuronal cells. PMID: 27478015
  9. The promoter methylation levels of GATA3, IL-4, and TGF-beta were significantly higher in active VKH patients than in healthy individuals PMID: 28278322
  10. A positive association exists between the IL-4R Q551R polymorphism and occurrence of chronic periodontitis. PMID: 28392616
  11. Single nucleotide polymorphism of IL-4Ralpha 175 V was linked to greater Atopic dermatitis risk at 2 to 3 years of age. PMID: 27274543
  12. IL-4Ralpha gene (I50V) polymorphism may play a role in development of eczema among Saudi children PMID: 27018548
  13. genetic polymorphism is associated with autoimmune hepatitis in Brazilian children PMID: 26693492
  14. IL4Rrs2107356 and IL8rs2227307 SNPs were associated with an increased risk of invasive aspergillosis. PMID: 26667837
  15. Essential role of endocytosis for interleukin-4-receptor-mediated JAK/STAT signalling. PMID: 26306492
  16. analysis of IL-4 and IL-13 receptors in cancer biology and discussion of pre-clinical and clinical studies pertaining to recombinant immunotoxins designed to target these receptors [review] PMID: 26088753
  17. review of IL-4 and IL-13 receptor structure, receptor regulation, signaling and experimental therapeutics [review] PMID: 26187331
  18. There is no correlation between the Arg551Gln polymorphism in IL-4R gene and asthma predictive index results PMID: 26695670
  19. Studies indicate significant association between the interleukin-4receptor (IL-4R) Q576R polymorphism and the risk of asthma in the Chinese Han population. PMID: 25867440
  20. Results illustrated that Saudi vitiligo patients showed significantly higher frequency of the IL-4R (Q551R A>G) homozygous GG variant (recessive mode) as compared with their respective controls PMID: 23774696
  21. higher frequency of polymorphisms in patients with familial hypercholesterolemia PMID: 25110223
  22. IL-4RA-1902 A/A genotype has been associated with a reduced response to IL-4 and has been found in 90% oral mucous membrane pemphigoid patient PMID: 23557074
  23. Genetic variants of NOS3, CD14, MMP3 and IL4R are implicated in the determination of VEGF expression and plasma levels. PMID: 26437765
  24. IL4R mediates enhanced glucose and glutamine metabolism in breast cancer cells. PMID: 25746764
  25. Receptor trafficking may play an important role for the regulation of IL-4R-mediated JAK/STAT signaling. PMID: 25468331
  26. Gene interactions were observed between IL4R and TNF-alpha genes in hand osteoarthritis patients. PMID: 25252624
  27. Selective augmentation of IL-4Ralpha signaling in Treg cells induced their reprogramming into Th2-like cells and disease susceptibility towards food allergy. PMID: 25769611
  28. Data show that high expression of interleukin-4 receptor IL-4Ralpha correlated with increased recurrence, while interleukin-13 receptor IL-13Ralpha1 had an inverse relationship to recurrence and survival in oral cavity squamous cell carcinoma patients. PMID: 25483786
  29. Higher TGF-beta with lower CD124 and TSLP, but no difference in PAR-2 expression in bronchial biopsy of bronchial asthma patients in comparison with COPD patients. PMID: 24185116
  30. Analysis of IL4R SNP haplotypes or complex alleles suggested no dominant protection in patients with Recurrent spontaneous abortion PMID: 24803421
  31. Results suggest that the physical interaction between the cytoplasmic domains of IL-13Ralpha2 and IL-4Ralpha regulates IL-4 signaling through the IL-4Ralpha-IL-13Ralpha1 receptor complex. PMID: 24056919
  32. increased expression in B cells of patients with house dust mites allergic asthma PMID: 24975796
  33. The binding of [AP1-V12]6 to cancer cells was remarkably reduced when IL-4 receptors were blocked by antibody against IL-4 receptor further confirmed its binding PMID: 24339977
  34. Increased Th17 cell frequency and poor clinical outcome in rheumatoid arthritis are associated with a genetic variant in the IL4R gene, rs1805010. PMID: 24782180
  35. beta-defensin-2 and interleukin-4 receptor are biomarkers that improve the prediction of poor-outcome over clinical variables in the acute phase of stroke PMID: 24386991
  36. The IL4RA I50V and Q551R polymorphisms may be risk factors for developing asthma. PMID: 23922687
  37. This meta-analysis indicates that the I50V polymorphism of IL-4R gene may confer susceptibility to RA PMID: 23972290
  38. the polymorphism of IL-4Ralpha rs1801275 confers individual's variable susceptibility to glioma, particularly among Asians. PMID: 23979976
  39. Rs1805012 polymorphism of IL-4R gene is associated with asthma. PMID: 24510574
  40. Genetic variants in IL4R were identified, and their association with the progression rate of joint damage in rheumatoid arthritis was independently replicated. PMID: 23983153
  41. Single nucleotide polymorphisms in IL4R gene is associated with the risk of adult glioma. PMID: 23525950
  42. The rs1801275 in IL-4R showed an increased risk of glioblastoma. PMID: 23663500
  43. An meta-analysis suggests that the IL-4Ralpha rs1801275 polymorphism is not a genetic predictor for glioma. PMID: 23395224
  44. reduced IL-4R signalling has stage-specific effects on colorectal carcinogenesis (increased CRC initiation and risk but reduced tumour progression and no effect on CRC mortality). PMID: 23784081
  45. These findings support a pathogenic role for IL-4Ralpha on Th cells following respiratory syncytial virus reinfection PMID: 23543769
  46. Reduced interleukin-4 receptor alpha expression on CD8+ T cells correlates with higher quality anti-viral immunity. PMID: 23383283
  47. Data indicate that single nucleotide polymorphism (SNP) rs1805015 in the IL4Ralpha gene was significantly associated with eczema in the additive and dominant models. PMID: 23480403
  48. Passive smoking causes significant rise in plasma TNFa and IL4 with a dose dependent effect PMID: 23066418
  49. Interacting determinants of atopy, total IgE, IgE against prevalent allergens, and IL4RA polymorphisms, contribute to the high prevalence of betalactams allergy in South of Spain. PMID: 22764749
  50. A protective association for Hodgkin lymphoma was observed on the IL4R gene with haplotype TCA PMID: 22902050

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.
Protein Families
Type I cytokine receptor family, Type 4 subfamily
Tissue Specificity
Isoform 1 and isoform 2 are highly expressed in activated T-cells.
Database Links

HGNC: 6015

OMIM: 147781

KEGG: hsa:3566

STRING: 9606.ENSP00000170630

UniGene: Hs.513457

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*