Recombinant Human ATP-dependent RNA helicase DDX19B(DDX19B)

Code CSB-EP892352HU
Product Type Other
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. Q9UMR2
Relevance ATP-dependent RNA helicase involved in mRNA export from the nucleus. Rather than unwinding RNA duplexes, DDX19B functions as a remodeler of ribonucleoprotein particles, whereby proteins bound to nuclear mRNA are dissociated and replaced by cytoplasmic mRNA binding proteins.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Alias DEAD box RNA helicase DEAD5 DEAD box protein 19B DBP5, DDX19, TDBP
Species Homo sapiens (Human)
Biological_Activity Measured by its binding ability in a functional ELISA. Immobilized LCN2 at 2 μg/ml can bind human DDX19B, the EC50 of human DDX19B protein is 17.71-23.15 μg/ml.
Purity Greater than 85% as determined by SDS-PAGE.
Sequence ATDSWALAVDEQEAAAESLSNLHLKEEKIKPDTNGAVVKTNANAEKTDEEEKEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN
Research Area Signal Transduction
Source E.coli
Gene Names DDX19B
Expression Region 2-479aa
Tag Info N-terminal GST-tagged
Mol. Weight 80.8 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function ATP-dependent RNA helicase involved in mRNA export from the nucleus. Rather than unwinding RNA duplexes, DDX19B functions as a remodeler of ribonucleoprotein particles, whereby proteins bound to nuclear mRNA are dissociated and replaced by cytoplasmic mRNA binding proteins.
Subcellular Location Cytoplasm, Nucleus, nuclear pore complex, Nucleus membrane, Peripheral membrane protein, Cytoplasmic side
Protein Families DEAD box helicase family, DDX19/DBP5 subfamily
Database Links

HGNC: 2742

OMIM: 605812

KEGG: hsa:11269

STRING: 9606.ENSP00000288071

UniGene: Hs.221761

Related Products

DDX19B Antibodies

DDX19B Antibodies for Homo sapiens (Human)

DDX19B Proteins

DDX19B Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.