Recombinant Human B-cell antigen receptor complex-associated protein beta chain (CD79B),Partial (Active)

In Stock
Code CSB-MP004958HU1p7
Abbreviation Recombinant Human CD79B protein, partial (Active)
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human CD79B at 2 μg/ml can bind Anti-CD79B recombinant antibody(CSB-RA004958MA2HU). The EC50 is 31.97-35.69 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CD79B at 2 μg/mL can bind Anti-CD79B recombinant antibody(CSB-RA004958MA2HU). The EC50 is 31.97-35.69 ng/mL.
Target Names
Uniprot No.
Alternative Names
B-cell-specific glycoprotein B29;Ig-beta;Immunoglobulin-associated B29 protein;CD antigen CD79b
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
29-159aa
Target Protein Sequence
ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD
Mol. Weight
43.1 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-mFc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant human CD79B protein is expressed from HEK293 cells with 10*His tag and Avi tag at the C-Terminus. The target gene encodes the 29-159aa of the human CD79B. Its purity reaches up to 90% as determined by SDS-PAGE, and its endotoxin level is Less than 1.0 EU/ug as accessed by the LAL method. Its activity is measured by its binding ability with the anti-CD79B recombinant antibody (CSB-RA004958MA2HU) in a functional ELISA. The EC50 of this CD79B protein is 31.97-35.69 ng/mL.

The CD79B protein, a critical component of the B-cell receptor (BCR), serves several essential functions in B-cell biology and immunology. As a transmembrane protein, CD79B pairs with CD79A to form the BCR complex, which is crucial for B-cell activation, signaling, and development. The primary role of CD79B is to facilitate signal transduction upon antigen engagement, which is initiated by the phosphorylation of immunoreceptor tyrosine-based activation motifs (ITAMs) located in its cytoplasmic domain [1][2]. This phosphorylation event activates downstream signaling pathways involving various kinases, such as SYK and BLNK, leading to B-cell proliferation, differentiation, and survival [1][3][4].

Mutations in the CD79B gene, particularly in the ITAM region, have been associated with persistent BCR signaling, which can contribute to the survival of malignant B cells in conditions such as diffuse large B-cell lymphoma (DLBCL) [1][5][6]. These mutations can inhibit normal receptor internalization, resulting in enhanced BCR expression on the cell surface, which further promotes cell activation and survival [1][7].

Moreover, CD79B plays a role in the immune response beyond mere signal transduction. It has been implicated in the modulation of immune responses, where antibodies targeting CD79B can induce anergy in B cells, potentially preventing autoimmunity [8][9]. This suggests that CD79B not only facilitates B-cell activation but also has regulatory functions that can influence the overall immune landscape.

In the context of cancer, CD79B expression is often used as a biomarker for B-cell malignancies, and therapies targeting CD79B, such as antibody-drug conjugates, have shown promise in treating various B-cell lymphomas [6][10]. The ability of CD79B to mediate both positive and negative signals in B cells highlights its dual role in promoting immune responses while also providing a target for therapeutic intervention in malignancies.

References:
[1] W. Zhang, C. Huang, J. Liu, L. Wu, H. Zhang, X. Wu, et al. Genomic mutation landscape of primary breast lymphoma: next-generation sequencing analysis, Disease Markers, vol. 2022, p. 1-9, 2022. https://doi.org/10.1155/2022/6441139
[2] M. Mayzel, J. Rosenlow, L. Isaksson, & V. Orekhov. Time-resolved multidimensional nmr with non-uniform sampling, Journal of Biomolecular NMR, vol. 58, no. 2, p. 129-139, 2014. https://doi.org/10.1007/s10858-013-9811-1
[3] Z. Kuang, L. Guo, & X. Li. Identification of key genes and pathways associated with classical hodgkin lymphoma by bioinformatics analysis, Molecular Medicine Reports, vol. 16, no. 4, p. 4685-4693, 2017. https://doi.org/10.3892/mmr.2017.7158
[4] J. Müller-Winkler, R. Mitter, J. Rappe, L. Vanes, E. Schweighoffer, H. Mohammadi, et al. Critical requirement for bcr, baff, and baffr in memory b cell survival, The Journal of Experimental Medicine, vol. 218, no. 2, 2020. https://doi.org/10.1084/jem.20191393
[5] A. Arai, H. Takase, M. Yoshimori, K. Yamamoto, M. Mochizuki, & O. Miura. Gene expression profiling of primary vitreoretinal lymphoma, Cancer Science, vol. 111, no. 4, p. 1417-1421, 2020. https://doi.org/10.1111/cas.14347
[6] S. Corcoran. Molecular determinants of sensitivity to polatuzumab vedotin in diffuse large b-cell lymphoma, Cancer Discovery, p. OF1-OF22, 2024. https://doi.org/10.1158/2159-8290.cd-23-0802
[7] M. Pfeifer, B. Zheng, T. Erdmann, H. Koeppen, R. McCord, M. Grau, et al. Anti-cd22 and anti-cd79b antibody drug conjugates are active in different molecular diffuse large b-cell lymphoma subtypes, Leukemia, vol. 29, no. 7, p. 1578-1586, 2015. https://doi.org/10.1038/leu.2015.48
[8] I. Hardy, N. Anceriz, F. Rousseau, M. Seefeldt, E. Hatterer, M. Irla, et al. Anti-cd79 antibody induces b cell anergy that protects against autoimmunity, The Journal of Immunology, vol. 192, no. 4, p. 1641-1650, 2014. https://doi.org/10.4049/jimmunol.1302672
[9] K. Renner, S. Neumayer, Y. Talke, S. Buchtler, K. Schmidbauer, F. Nimmerjahn, et al. B‐cell modulation with anti‐cd79b antibodies ameliorates experimental autoimmune encephalitis in mice, European Journal of Immunology, vol. 52, no. 4, p. 656-668, 2022. https://doi.org/10.1002/eji.202149523
[10] F. Fuh, C. Looney, D. Li, K. Poon, R. Dere, D. Danilenko, et al. Anti‐cd22 and anti‐cd79b antibody‐drug conjugates preferentially target proliferating b cells, British Journal of Pharmacology, vol. 174, no. 8, p. 628-640, 2017. https://doi.org/10.1111/bph.13697

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Enhances phosphorylation of CD79A, possibly by recruiting kinases which phosphorylate CD79A or by recruiting proteins which bind to CD79A and protect it from dephosphorylation.
Gene References into Functions
  1. CD79B mutations were found in six of 19 cases (31.6%) of primary CNS diffuse large B-cell lymphoma , all in the Y196 mutation hotspot PMID: 28856744
  2. Patients with primary breast and primary female genital tract diffuse large B cell lymphoma have a high frequency of CD79B mutations. PMID: 28803429
  3. hotspot mutations of CD79B Y196 and MYD88 L265 may serve as a genetic hallmark for primary central nervous system lymphoma PMID: 26111727
  4. CD79B overexpression leading to activation of AKT/MAPK is a potential mechanism underlying primary ibrutinib resistance in ABC-DLBCL, and support its utility as an effective biomarker to predict therapeutic response to ibrutinib. PMID: 26699656
  5. Novel CD79B variations in mature B-cell non-Hodgkin's lymphoma patients were detected. PMID: 27010137
  6. MYD88 L265P and CD79B mutations were frequently detected in primary breast diffuse large B-cell lymphoma. PMID: 26752547
  7. Oncogenic CD79B mutation is associated with primary diffuse large B-cell lymphomas of central nervous system. PMID: 25347427
  8. Diffuse large B cell lymphomas relapsing in the CNS lack oncogenic MYD88 and CD79B mutations. PMID: 25501023
  9. Abberant expression of CD79b in non-B cells caused unwanted reactivity, rendering CD79b unsuitable for T-cell receptor - based immunotherapies. PMID: 25414443
  10. results suggest that MYD88 mutations, and to a lesser extent CD79B mutations, are important drivers of lymphomagenesis in PTL PMID: 24253023
  11. CD79B and MYD88 mutations are associated with an older age at onset in diffuse large b-cell lymphoma with a significant overlap, which did not affect the outcome of the disease. PMID: 24444466
  12. CD79B point mutation is associated with B-cell non-Hodgkin lymphomas. PMID: 23361872
  13. Data indicate a secondary promoter located within exon 2 maintained full levels and specificity of hCD79b transcription. PMID: 23649625
  14. The present study failed to find any mut-ation in MYD88, CARD11 or CD79B in ocular MALT lymphoma. PMID: 22808296
  15. Expression of CD79b is downregulated in both plasma cells and plasma cell myeloma. PMID: 21355953
  16. The B cell-specific B29 gene promoter is transactivated in B and non-B cells by cotransfection with the B cell-specific octamer cofactor gene, Bob1 (OCA-B/OBF-1). PMID: 11907094
  17. The alternative splicing variant DeltaCD79b may be a powerful modulator of BCR signaling that may play an important role in normal and malignant B cell PMID: 12384401
  18. Following B cell receptor cross-linking, a significant amount of the transgenic Ig beta pool (together with Ig alpha) remains on the B cell surface independent of surface immunoglobulin internalization. PMID: 15661909
  19. Results reveal tissue-specific patterns of chromatin structures and transcriptional controls at the CD79b/GH locus in B cells distinct from those in the pituitary gland and placenta. PMID: 16847312
  20. establish a strong linkage between Igbeta mRNA expression and somatic hypermutation in chronic lymphocytic leukaemia and highlight the complex relationships between biochemical parameters and clinical status in this disease PMID: 17315213
  21. Ig-beta was phosphorylated in about 20% of myeloma IgG BCR isolates, but not in normal B-cell controls. PMID: 17701175
  22. These results indicate that mutations in Igbeta can cause agammaglobulinemia in man. PMID: 17709424
  23. mutations responsible for agammaglobulinemia in humans PMID: 18978465

Show More

Hide All

Involvement in disease
Agammaglobulinemia 6, autosomal recessive (AGM6)
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
B-cells.
Database Links

HGNC: 1699

OMIM: 147245

KEGG: hsa:974

STRING: 9606.ENSP00000376544

UniGene: Hs.89575

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*