Product Details

Purity

≥ 90% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human CD79B at 2 μg/mL can bind Anti-CD79B recombinant antibody(CSB-RA004958MA2HU). The EC50 is 31.97-35.69 ng/mL.

Target Names

CD79B

Uniprot No.

P40259

Alternative Names

B-cell-specific glycoprotein B29;Ig-beta;Immunoglobulin-associated B29 protein;CD antigen CD79b

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

29-159aa

Target Protein Sequence

ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Mol. Weight

43.1 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-mFc-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

CD79B forms the signaling component of the B-cell receptor complex and is a validated target for therapeutic antibodies in B-cell malignancies, making reliable extracellular domain proteins essential for antibody development workflows. This construct spans residues 29–159 and demonstrates quantifiable antibody-binding activity with an EC50 of 31.97–35.69 ng/mL in functional ELISA, providing a suitable basis for competitive inhibition assays, blocking antibody screening, and therapeutic antibody epitope mapping. Mammalian expression preserves the native glycosylation and disulfide architecture required for physiologically relevant receptor-antibody interactions in surface plasmon resonance, biolayer interferometry, and affinity characterization experiments. With purity exceeding 90% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for drug discovery campaigns targeting B-cell surface receptors and for use as a positive control in binding assays evaluating anti-CD79B biologics.

Target Background

Function

Required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Enhances phosphorylation of CD79A, possibly by recruiting kinases which phosphorylate CD79A or by recruiting proteins which bind to CD79A and protect it from dephosphorylation.

Gene References into Functions

CD79B mutations were found in six of 19 cases (31.6%) of primary CNS diffuse large B-cell lymphoma , all in the Y196 mutation hotspot PMID: 28856744
Patients with primary breast and primary female genital tract diffuse large B cell lymphoma have a high frequency of CD79B mutations. PMID: 28803429
hotspot mutations of CD79B Y196 and MYD88 L265 may serve as a genetic hallmark for primary central nervous system lymphoma PMID: 26111727
CD79B overexpression leading to activation of AKT/MAPK is a potential mechanism underlying primary ibrutinib resistance in ABC-DLBCL, and support its utility as an effective biomarker to predict therapeutic response to ibrutinib. PMID: 26699656
Novel CD79B variations in mature B-cell non-Hodgkin's lymphoma patients were detected. PMID: 27010137
MYD88 L265P and CD79B mutations were frequently detected in primary breast diffuse large B-cell lymphoma. PMID: 26752547
Oncogenic CD79B mutation is associated with primary diffuse large B-cell lymphomas of central nervous system. PMID: 25347427
Diffuse large B cell lymphomas relapsing in the CNS lack oncogenic MYD88 and CD79B mutations. PMID: 25501023
Abberant expression of CD79b in non-B cells caused unwanted reactivity, rendering CD79b unsuitable for T-cell receptor - based immunotherapies. PMID: 25414443
results suggest that MYD88 mutations, and to a lesser extent CD79B mutations, are important drivers of lymphomagenesis in PTL PMID: 24253023
CD79B and MYD88 mutations are associated with an older age at onset in diffuse large b-cell lymphoma with a significant overlap, which did not affect the outcome of the disease. PMID: 24444466
CD79B point mutation is associated with B-cell non-Hodgkin lymphomas. PMID: 23361872
Data indicate a secondary promoter located within exon 2 maintained full levels and specificity of hCD79b transcription. PMID: 23649625
The present study failed to find any mut-ation in MYD88, CARD11 or CD79B in ocular MALT lymphoma. PMID: 22808296
Expression of CD79b is downregulated in both plasma cells and plasma cell myeloma. PMID: 21355953
The B cell-specific B29 gene promoter is transactivated in B and non-B cells by cotransfection with the B cell-specific octamer cofactor gene, Bob1 (OCA-B/OBF-1). PMID: 11907094
The alternative splicing variant DeltaCD79b may be a powerful modulator of BCR signaling that may play an important role in normal and malignant B cell PMID: 12384401
Following B cell receptor cross-linking, a significant amount of the transgenic Ig beta pool (together with Ig alpha) remains on the B cell surface independent of surface immunoglobulin internalization. PMID: 15661909
Results reveal tissue-specific patterns of chromatin structures and transcriptional controls at the CD79b/GH locus in B cells distinct from those in the pituitary gland and placenta. PMID: 16847312
establish a strong linkage between Igbeta mRNA expression and somatic hypermutation in chronic lymphocytic leukaemia and highlight the complex relationships between biochemical parameters and clinical status in this disease PMID: 17315213
Ig-beta was phosphorylated in about 20% of myeloma IgG BCR isolates, but not in normal B-cell controls. PMID: 17701175
These results indicate that mutations in Igbeta can cause agammaglobulinemia in man. PMID: 17709424
mutations responsible for agammaglobulinemia in humans PMID: 18978465

Hide All

Involvement in disease

Agammaglobulinemia 6, autosomal recessive (AGM6)

Subcellular Location

Cell membrane; Single-pass type I membrane protein.

Tissue Specificity

B-cells.

Database Links

HGNC: 1699

OMIM: 147245

KEGG: hsa:974

STRING: 9606.ENSP00000376544

UniGene: Hs.89575

Code	CSB-MP004958HU1p7
Abbreviation	Recombinant Human CD79B protein, partial (Active)
MSDS	MSDS Datasheet
Size	$138
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human CD79B at 2 μg/ml can bind Anti-CD79B recombinant antibody(CSB-RA004958MA2HU). The EC₅₀ is 31.97-35.69 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human B-cell antigen receptor complex-associated protein beta chain (CD79B),Partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage