Recombinant Human B-cell antigen receptor complex-associated protein beta chain (CD79B)

Code CSB-CF004958HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
CD79B; B29; IGB; B-cell antigen receptor complex-associated protein beta chain; B-cell-specific glycoprotein B29; Ig-beta; Immunoglobulin-associated B29 protein; CD antigen CD79b
Species
Homo sapiens (Human)
Expression Region
29-229
Target Protein Sequence
ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Enhances phosphorylation of CD79A, possibly by recruiting kinases which phosphorylate CD79A or by recruiting proteins which bind to CD79A and protect it from dephosphorylation.
Gene References into Functions
  1. CD79B mutations were found in six of 19 cases (31.6%) of primary CNS diffuse large B-cell lymphoma , all in the Y196 mutation hotspot PMID: 28856744
  2. Patients with primary breast and primary female genital tract diffuse large B cell lymphoma have a high frequency of CD79B mutations. PMID: 28803429
  3. hotspot mutations of CD79B Y196 and MYD88 L265 may serve as a genetic hallmark for primary central nervous system lymphoma PMID: 26111727
  4. CD79B overexpression leading to activation of AKT/MAPK is a potential mechanism underlying primary ibrutinib resistance in ABC-DLBCL, and support its utility as an effective biomarker to predict therapeutic response to ibrutinib. PMID: 26699656
  5. Novel CD79B variations in mature B-cell non-Hodgkin's lymphoma patients were detected. PMID: 27010137
  6. MYD88 L265P and CD79B mutations were frequently detected in primary breast diffuse large B-cell lymphoma. PMID: 26752547
  7. Oncogenic CD79B mutation is associated with primary diffuse large B-cell lymphomas of central nervous system. PMID: 25347427
  8. Diffuse large B cell lymphomas relapsing in the CNS lack oncogenic MYD88 and CD79B mutations. PMID: 25501023
  9. Abberant expression of CD79b in non-B cells caused unwanted reactivity, rendering CD79b unsuitable for T-cell receptor - based immunotherapies. PMID: 25414443
  10. results suggest that MYD88 mutations, and to a lesser extent CD79B mutations, are important drivers of lymphomagenesis in PTL PMID: 24253023
  11. CD79B and MYD88 mutations are associated with an older age at onset in diffuse large b-cell lymphoma with a significant overlap, which did not affect the outcome of the disease. PMID: 24444466
  12. CD79B point mutation is associated with B-cell non-Hodgkin lymphomas. PMID: 23361872
  13. Data indicate a secondary promoter located within exon 2 maintained full levels and specificity of hCD79b transcription. PMID: 23649625
  14. The present study failed to find any mut-ation in MYD88, CARD11 or CD79B in ocular MALT lymphoma. PMID: 22808296
  15. Expression of CD79b is downregulated in both plasma cells and plasma cell myeloma. PMID: 21355953
  16. The B cell-specific B29 gene promoter is transactivated in B and non-B cells by cotransfection with the B cell-specific octamer cofactor gene, Bob1 (OCA-B/OBF-1). PMID: 11907094
  17. The alternative splicing variant DeltaCD79b may be a powerful modulator of BCR signaling that may play an important role in normal and malignant B cell PMID: 12384401
  18. Following B cell receptor cross-linking, a significant amount of the transgenic Ig beta pool (together with Ig alpha) remains on the B cell surface independent of surface immunoglobulin internalization. PMID: 15661909
  19. Results reveal tissue-specific patterns of chromatin structures and transcriptional controls at the CD79b/GH locus in B cells distinct from those in the pituitary gland and placenta. PMID: 16847312
  20. establish a strong linkage between Igbeta mRNA expression and somatic hypermutation in chronic lymphocytic leukaemia and highlight the complex relationships between biochemical parameters and clinical status in this disease PMID: 17315213
  21. Ig-beta was phosphorylated in about 20% of myeloma IgG BCR isolates, but not in normal B-cell controls. PMID: 17701175
  22. These results indicate that mutations in Igbeta can cause agammaglobulinemia in man. PMID: 17709424
  23. mutations responsible for agammaglobulinemia in humans PMID: 18978465

Show More

Hide All

Involvement in disease
Agammaglobulinemia 6, autosomal recessive (AGM6)
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
B-cells.
Database Links

HGNC: 1699

OMIM: 147245

KEGG: hsa:974

STRING: 9606.ENSP00000376544

UniGene: Hs.89575

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1