Recombinant Human Carbonic anhydrase 4(CA4),partial (Active)

Unavailable
Code CSB-AP005631HU
Size US$3267Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The esterase activity is determined to be greater than 500 pmol/min/ug
Target Names CA4
Uniprot No. P22748
Research Area Neuroscience
Alternative Names CA IV; CA4; CAH4_HUMAN; CAIV ; Car4 ; Carbonate dehydratase IV; Carbonic anhydrase 4; Carbonic dehydratase; Carbonic dehydratase IV ; EC 4.2.1.1; Retinitis pigmentosa 17 (autosomal dominant); RP17
Species Homo sapiens (Human)
Source E.coli
Expression Region 19-283aa
Complete Sequence AESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIK
Mol. Weight 31.43 kDa
Protein Length Partial
Tag Info C-terminal 6xHis-tagged
Form Liquid
Buffer 0.2 μm filtered 20 mM Tris-HCl, 100 mM NaCl, pH 8.5
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Background

Function
(From Uniprot)
Reversible hydration of carbon dioxide. May stimulate the sodium/bicarbonate transporter activity of SLC4A4 that acts in pH homeostasis. It is essential for acid overload removal from the retina and retina epithelium, and acid release in the choriocapillaris in the choroid.
Gene References into Functions
  1. CA4 is a novel tumour suppressor in Colorectal cancer through the inhibition of the Wnt signalling pathway by targeting the WTAP-WT1-TBL1 axis. CA4 methylation may serve as an independent biomarker for the recurrence of Colorectal cancer . PMID: 26071132
  2. Carbonic anhydrase 4 is lost in papillary thyroid carcinoma but not thyroid nodules PMID: 24880201
  3. Although CA IV has been shown to be active in mediating CO2 and HCO3 (-) transport in many important tissues like kidney and lung, and in isolated cells from brain and muscle, the gene for CA IV appears not to be essential. PMID: 24146379
  4. Coexpression of CAIV with MCT1 and MCT4 resulted in a significant increase in MCT transport activity. PMID: 24338019
  5. membrane-associated CA IV contributes robust catalytic activity intracellularly, and this activity participates in regulating H(+) dynamics in the cytosol PMID: 23297198
  6. Two SNPs of carbonic anhydrase IV, which are responsible for amino acid changes, were found. The frequencies of these SNPs were not significantly different between the caries-free group and the group with caries PMID: 22021688
  7. compared the subcellular localization and post-translational processing of wild-type (WT)- and retinitis pigmentosa 17 mutant-CAIV in three cell types PMID: 20626030
  8. The results suggest that the expression level of carbonic anhydrase IV may be important to maintain retina function in retinitis pigmentosa. PMID: 20450258
  9. renal injury inflicted by expression of human carbonic anhydrase IV folding mutants was markedly enhanced by haploinsufficiency of the endoplasmic reticulum cochaperone p58(IPK). PMID: 20308551
  10. binding by extracellular loop 4 of the human AE1 Cl-/HCO3- exchanger PMID: 11994299
  11. carbonic anhydrase IV binds EC4 of NBC1, and this interaction is essential for full NBC1 activity PMID: 14567693
  12. mutation was found to cosegregate with the retinitis pigmentosa RP17 phenotype in two large families PMID: 15090652
  13. CA inhibitors may have long-term adverse effects on vision. PMID: 15563508
  14. characterized the CA IV expressed in Capan-1 cells PMID: 17409381
  15. A novel mutation has been identified in CA4 that provides further evidence that impaired pH regulation may underlie photoreceptor degeneration in retinitis pigmentosa PMID: 17652713
  16. CAIV p.R14W sequence variant found in one of the patients with Bothnia dystrophy phenotype is benign polymorphism in population of northern Sweden. PMID: 18344446
  17. Apoptosis induced by the CA IV mutants could be prevented, at least partially, by treating the cells with dorzolamide, a CA inhibitor PMID: 19211803

Show More

Hide All

Involvement in disease Retinitis pigmentosa 17 (RP17)
Subcellular Location Cell membrane, Lipid-anchor, GPI-anchor
Protein Families Alpha-carbonic anhydrase family
Tissue Specificity Expressed in the endothelium of the choriocapillaris in eyes (at protein level). Not expressed in the retinal epithelium at detectable levels.
Database Links

HGNC: 1375

OMIM: 114760

KEGG: hsa:762

STRING: 9606.ENSP00000300900

UniGene: Hs.89485

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1