Recombinant Human Malate dehydrogenase, cytoplasmic (MDH1) (Active)

Unavailable
Code CSB-AP005651HU
MSDS
Size $290
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
Its dehydrogenation activity from (S)-malate to oxaloacetate in the presense of NAD+ is determined to be greater than 1000 pmol/min/ug
Target Names
MDH1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
cytoplasmic; Cytosolic malate dehydrogenase; Diiodophenylpyruvate reductase; Malate dehydrogenase 1, NAD (soluble); Malate dehydrogenase; Malate dehydrogenase cytoplasmic; MDH s; mdh1; MDHA; MDHC_HUMAN; MDHs; MGC:1375; MOR2; Soluble malate dehydrogenase
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-334aa
Complete Sequence
SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA
Mol. Weight
37.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid
Buffer
0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human MDH1 is a full-length cytoplasmic malate dehydrogenase protein, including the 2-334aa expression region. Sourced from E. coli, this protein has a C-terminal 6xHis-tag and plays a vital role in signal transduction research. Demonstrating a purity of greater than 95% as verified by SDS-PAGE, MDH1 maintains an endotoxin level of less than 1.0 EU/µg, as determined by the LAL method. This protein showcases a robust dehydrogenation activity, converting (S)-malate to oxaloacetate in the presence of NAD+ at a rate greater than 1000 pmol/min/µg. The lyophilized powder format ensures ease of storage and application in a wide range of research endeavors.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the reduction of aromatic alpha-keto acids in the presence of NADH. Plays essential roles in the malate-aspartate shuttle and the tricarboxylic acid cycle, important in mitochondrial NADH supply for oxidative phosphorylation.
Gene References into Functions
  1. expression of miR-126-5p suppresses the enzymatic activity of MDH1, mitochondrial respiration and caused cell death in non-small cell lung carcinoma cell lines. PMID: 29574159
  2. Data show that in the endogenous readthrough of the human MDH1 stop codon, the stop codon can encode tryptophan and arginine, and is tissue-specific. PMID: 27881739
  3. Proliferating cells rely on both MDH1 and LDH to replenish cytosolic NAD. PMID: 28263970
  4. Arginine methylation of MDH1 by CARM1 regulates cellular redox homeostasis and suppresses glutamine metabolism of pancreatic cancer. PMID: 27840030
  5. adipogenic differentiation may be regulated by the acetylation of MDH1 PMID: 22693256
  6. The MDH1 gene is not the cause of RP28-linked autosomal recessive retinitis pigmentosa. PMID: 20011630
  7. expression of MDH1 is maintained in the adult heart but is not present in levels as high as in the fetus PMID: 15565635
  8. Malate Dehydrogenase directly regulates the Tumor Suppressor Protein p53-dependent apoptosis upon glucose deprivation and involved in maintaining cellular metabolic state and further determining cell death. PMID: 19229245

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
LDH/MDH superfamily, MDH type 2 family
Database Links

HGNC: 6970

OMIM: 154200

KEGG: hsa:4190

STRING: 9606.ENSP00000438144

UniGene: Hs.526521

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*