Recombinant Human Malate dehydrogenase, cytoplasmic(MDH1) (Active)

In Stock
Code CSB-AP005651HU
Size US$3267Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity Its dehydrogenation activity from (S)-malate to oxaloacetate in the presense of NAD+ is determined to be greater than 1000 pmol/min/ug
Target Names MDH1
Uniprot No. P40925
Research Area Signal Transduction
Alternative Names cytoplasmic; Cytosolic malate dehydrogenase; Diiodophenylpyruvate reductase; Malate dehydrogenase 1, NAD (soluble); Malate dehydrogenase; Malate dehydrogenase cytoplasmic; MDH s; mdh1; MDHA; MDHC_HUMAN; MDHs; MGC:1375; MOR2; Soluble malate dehydrogenase
Species Homo sapiens (Human)
Source E.coli
Expression Region 2-334aa
Complete Sequence SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA
Mol. Weight 37.5 kDa
Protein Length Full Length of Mature Protein
Tag Info C-terminal 6xHis-tagged
Form Liquid
Buffer 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Background

Gene References into Functions
  1. expression of miR-126-5p suppresses the enzymatic activity of MDH1, mitochondrial respiration and caused cell death in non-small cell lung carcinoma cell lines. PMID: 29574159
  2. Data show that in the endogenous readthrough of the human MDH1 stop codon, the stop codon can encode tryptophan and arginine, and is tissue-specific. PMID: 27881739
  3. Proliferating cells rely on both MDH1 and LDH to replenish cytosolic NAD. PMID: 28263970
  4. Arginine methylation of MDH1 by CARM1 regulates cellular redox homeostasis and suppresses glutamine metabolism of pancreatic cancer. PMID: 27840030
  5. adipogenic differentiation may be regulated by the acetylation of MDH1 PMID: 22693256
  6. The MDH1 gene is not the cause of RP28-linked autosomal recessive retinitis pigmentosa. PMID: 20011630
  7. expression of MDH1 is maintained in the adult heart but is not present in levels as high as in the fetus PMID: 15565635
  8. Malate Dehydrogenase directly regulates the Tumor Suppressor Protein p53-dependent apoptosis upon glucose deprivation and involved in maintaining cellular metabolic state and further determining cell death. PMID: 19229245

Show More

Hide All

Subcellular Location Cytoplasm
Protein Families LDH/MDH superfamily, MDH type 2 family
Database Links

HGNC: 6970

OMIM: 154200

KEGG: hsa:4190

STRING: 9606.ENSP00000438144

UniGene: Hs.526521

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1