Home
Active Protein
Other
Recombinant Human Malate dehydrogenase, cytoplasmic (MDH1) (Active)

Recombinant Human Malate dehydrogenase, cytoplasmic (MDH1) (Active)

^Unavailable

Code	CSB-AP005651HU
MSDS	MSDS Datasheet
Size	$290
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Activity

Its dehydrogenation activity from (S)-malate to oxaloacetate in the presense of NAD+ is determined to be greater than 1000 pmol/min/ug

Target Names

MDH1

Uniprot No.

P40925

Research Area

Signal Transduction

Alternative Names

cytoplasmic; Cytosolic malate dehydrogenase; Diiodophenylpyruvate reductase; Malate dehydrogenase 1, NAD (soluble); Malate dehydrogenase; Malate dehydrogenase cytoplasmic; MDH s; mdh1; MDHA; MDHC_HUMAN; MDHs; MGC:1375; MOR2; Soluble malate dehydrogenase

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

2-334aa

Complete Sequence

SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA

Mol. Weight

37.5 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal 6xHis-tagged

Form

Liquid

Buffer

0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Recombinant Human MDH1 is a full-length cytoplasmic malate dehydrogenase protein, including the 2-334aa expression region. Sourced from E. coli, this protein has a C-terminal 6xHis-tag and plays a vital role in signal transduction research. Demonstrating a purity of greater than 95% as verified by SDS-PAGE, MDH1 maintains an endotoxin level of less than 1.0 EU/µg, as determined by the LAL method. This protein showcases a robust dehydrogenation activity, converting (S)-malate to oxaloacetate in the presence of NAD+ at a rate greater than 1000 pmol/min/µg. The lyophilized powder format ensures ease of storage and application in a wide range of research endeavors.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Catalyzes the reduction of aromatic alpha-keto acids in the presence of NADH. Plays essential roles in the malate-aspartate shuttle and the tricarboxylic acid cycle, important in mitochondrial NADH supply for oxidative phosphorylation.

Gene References into Functions

expression of miR-126-5p suppresses the enzymatic activity of MDH1, mitochondrial respiration and caused cell death in non-small cell lung carcinoma cell lines. PMID: 29574159
Data show that in the endogenous readthrough of the human MDH1 stop codon, the stop codon can encode tryptophan and arginine, and is tissue-specific. PMID: 27881739
Proliferating cells rely on both MDH1 and LDH to replenish cytosolic NAD. PMID: 28263970
Arginine methylation of MDH1 by CARM1 regulates cellular redox homeostasis and suppresses glutamine metabolism of pancreatic cancer. PMID: 27840030
adipogenic differentiation may be regulated by the acetylation of MDH1 PMID: 22693256
The MDH1 gene is not the cause of RP28-linked autosomal recessive retinitis pigmentosa. PMID: 20011630
expression of MDH1 is maintained in the adult heart but is not present in levels as high as in the fetus PMID: 15565635
Malate Dehydrogenase directly regulates the Tumor Suppressor Protein p53-dependent apoptosis upon glucose deprivation and involved in maintaining cellular metabolic state and further determining cell death. PMID: 19229245