Product Details

Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

①Measured by its binding ability in a functional ELISA. Immobilized Human SELP at 2 μg/mL can bind Anti-SELP recombinant antibody (CSB-RA020978MA2HU). The EC50 is 3.120-3.578 ng/mL.
②SELP Recombinant Monoclonal Antibody (CSB-RA020978MA2HU) captured on Protein A Chip can bind Recombinant Human SELP with an affinity constant of 0.956 nM as detected by MetaSPR Assay (WeSPRTM 200).

Target Names

SELP

Uniprot No.

P16109

Alternative Names

P-selectin; CD62 antigen-like family member P; Granule membrane protein 140; GMP-140; Leukocyte-endothelial cell adhesion molecule 3; LECAM3; Platelet activation dependent granule-external membrane protein; PADGEM; CD antigen CD62P

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

42-771aa(V640L)

Target Protein Sequence

WTYHYSTKAYSWNISRKYCQNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADNEPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFHCTDGYQVNGPSKLECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGFALVGPEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCVHPLTAFAYGSSCKFECQPGYRVRGLDMLRCIDSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFMLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNEGLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCQFICDEGYSLSGPERLDCTRSGRWTDSPPMCEAIKCPELFAPEQGSLDCSDTRGEFNVGSTCHFSCDNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGLQCPALTTPGQGTMYCRHHPGTFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNLWGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEA

Mol. Weight

81.3 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

P-selectin mediates the initial tethering and rolling of leukocytes on activated endothelium and platelets, a critical step in inflammation and metastasis that has made it a therapeutic target in cancer and cardiovascular disease. This mammalian-expressed construct spanning residues 42–771 with the V640L variant retains native glycosylation and demonstrates quantified binding to a recombinant anti-SELP antibody with an EC50 of 3.120–3.578 ng/mL in functional ELISA and a KD of 0.956 nM by surface plasmon resonance, confirming that the extracellular domain adopts a conformation competent for ligand recognition. These binding parameters support use in selectin-ligand interaction studies, antibody development and epitope mapping, and cell adhesion assays investigating leukocyte rolling or tumor cell arrest on endothelial monolayers. Purity exceeding 95% by SDS-PAGE and endotoxin below 1.0 EU/μg meet the quality thresholds commonly required for functional cell-based assays and in vitro binding experiments.

Code	CSB-MP020978HU(M)d7
Abbreviation	Recombinant Human SELP protein (V640L), partial (Active)
MSDS	MSDS Datasheet
Size	$102
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human SELP at 2 μg/ml can bind Anti-SELP recombinant antibody (CSB-RA020978MA2HU). The EC₅₀ is 3.120-3.578 ng/mL. Biological Activity Assay Activity SELP Recombinant Monoclonal Antibody (CSB-RA020978MA2HU) captured on Protein A Chip can bind Recombinant Human SELP with an affinity constant of 0.956 nM as detected by MetaSPR Assay (WeSPRTM 200). Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human P-selectin (SELP) (V640L), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage