Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TFPI at 1 μg/mL can bind Anti-TFPI recombinant antibody (CSB-RA023437MA01HU), the EC50 is 1.242-1.788 ng/mL.
Alternative Names
(TFPI)(Extrinsic pathway inhibitor)(EPI)(Lipoprotein-associated coagulation inhibitor)(LACI)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
29-282aa
Target Protein Sequence
DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIK
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The gene sequence encoding the 29-282aa of the human tissue factor pathway inhibitor (TFPI) was fused with a C-terminal 10xHis-tag and then cloned into an expression vector to form the cloned vector. The cloned vector was transformed into mammalian cells for subsequent expression after appropriate induction. The product is the C-terminal 10xHis-tagged recombinant human TFPI protein. Its purity is over 95% assessed by SDS-PAGE. Its endotoxin level is less than 1.0 EU/ug measured by the LAL method. In the functional ELISA, this recombinant TFPI protein has been validated to be active by binding to the anti-TFPI recombinant antibody.
TFPI, constitutively expressed and secreted by the vascular endothelium, is the principal inhibitor of TF-initiated coagulation. It binds and inhibits TF·FVIIa in an FXa-dependent manner, thus directly suppressing the initiation phase of coagulation. TFPI's inhibitory activity is executed via a mode that is common to other Kunitz-type inhibitors. Given TFPI's obvious importance in hemostasis regulation, it's possible that TFPI deficiency contributes to the etiology of thrombotic diseases.
