Recombinant Human Tissue factor pathway inhibitor (TFPI), partial (Active)

In Stock
Code CSB-MP023437HU
Abbreviation Recombinant Human TFPI protein, partial (Active)
MSDS
Size $148
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human TFPI at 1 μg/ml can bind Anti-TFPI recombinant antibody (CSB-RA023437MA01HU), the EC50 is 1.242-1.788 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TFPI at 1 μg/mL can bind Anti-TFPI recombinant antibody (CSB-RA023437MA01HU), the EC50 is 1.242-1.788 ng/mL.
Target Names
Uniprot No.
Alternative Names
(TFPI)(Extrinsic pathway inhibitor)(EPI)(Lipoprotein-associated coagulation inhibitor)(LACI)
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
29-282aa
Target Protein Sequence
DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIK
Mol. Weight
31.9 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant human TFPI protein (amino acids 29-282) is produced in mammalian cells with a C-terminal 10×His tag, demonstrating high purity (>95% by SDS-PAGE) and low endotoxin levels (<1.0 EU/μg, LAL method). The recombinant TFPI protein exhibits strong biological activity, as evidenced by its specific binding to anti-TFPI antibody (CSB-RA023437MA01HU) in ELISA (EC50: 1.242-1.788 ng/mL at 1 μg/mL immobilization).

The mammalian expression system ensures proper folding and post-translational modifications critical for TFPI's anticoagulant function. The C-terminal 10×His tag facilitates purification while maintaining structural integrity. Presented as lyophilized powder, this preparation offers excellent stability and convenient handling.

The protein's demonstrated binding activity and high purity make it suitable for functional assays exploring TFPI's role in regulating tissue factor-mediated blood coagulation. Its mammalian origin ensures native-like characteristics for reliable experimental results in both basic and translational research applications.

Human TFPI is a critical regulator of the coagulation cascade, primarily functioning to limit the procoagulant activity initiated by the tissue factor (TF) and the factor VIIa (FVIIa) complex. TF is a transmembrane protein that, upon interaction with FVIIa, activates factors IX and X, leading to thrombin generation and subsequent clot formation. TFPI acts as an anticoagulant by binding to the TF-FVIIa complex and inhibiting factor Xa (FXa), thereby preventing further propagation of the coagulation cascade [1][2][3].

TFPI is categorized as a Kunitz-type serine protease inhibitor and exists in two forms: a membrane-bound variant on endothelial cells and a soluble form found in blood plasma [1][4]. This duality allows TFPI to perform immediate regulatory functions at sites of vascular injury while maintaining anticoagulant activity in circulation. The physiological importance of TFPI arises from its ability to modulate thrombus formation and may impact conditions such as atherosclerosis or acute thrombotic events [5][6].

The structure of TFPI includes three Kunitz-type domains, functioning together to ensure that it efficiently inhibits both the FVIIa-TF complex and FXa, the latter through a feedback mechanism that effectively halts the coagulation process [3][7]. The interaction between TFPI and FXa also leads to the formation of quaternary complexes that enhance the inhibition of the coagulation pathway [8]. Notably, under certain pathological conditions such as disseminated intravascular coagulation (DIC), TFPI levels may decrease, leading to enhanced thrombin generation and a hypercoagulable state [9][10].

Furthermore, TFPI's concentration in plasma can be influenced by several clinical conditions, including critical limb ischemia and various thrombophilic states [6][11][12]. The regulatory role of TFPI in inflammation and disease states further emphasizes its significance, positioning it as a potential therapeutic target in managing thromboembolic disorders [1][10][13].

References:
[1] E. Alan. Alternatively spliced tissue factor pathway inhibitor: functional implications. Frontiers in Bioscience-Elite, vol. S3, no. 1, p. 1457, 2011. https://doi.org/10.2741/236
[2] P. Stalboerger, C. Panetta, R. Simari, & N. Caplice. Plasmin proteolysis of endothelial cell and vessel wall associated tissue factor pathway inhibitor. Thrombosis and Haemostasis, vol. 86, no. 09, p. 923-928, 2001. https://doi.org/10.1055/s-0037-1616151
[3] M. Ndonwi, T. Girard, & G. Broze. The c‐terminus of tissue factor pathway inhibitor α is required for its interaction with factors v and va. Journal of Thrombosis and Haemostasis, vol. 10, no. 9, p. 1944-1946, 2012. https://doi.org/10.1111/j.1538-7836.2012.04834.x
[4] D. Eitzman, R. Westrick, et al. Lethal perinatal thrombosis in mice resulting from the interaction of tissue factor pathway inhibitor deficiency and factor v leiden. Circulation, vol. 105, no. 18, p. 2139-2142, 2002. https://doi.org/10.1161/01.cir.0000017361.39256.82
[5] T. Koudriavtseva, S. Lorenzano, et al. Tissue factor as a potential coagulative/vascular marker in relapsing-remitting multiple sclerosis. Frontiers in Immunology, vol. 14, 2023. https://doi.org/10.3389/fimmu.2023.1226616
[6] R. Wieczór, A. Kulwas, & D. Rość. Implications of hemostasis disorders in patients with critical limb ischemia—an in-depth comparison of selected factors. Journal of Clinical Medicine, vol. 9, no. 3, p. 659, 2020. https://doi.org/10.3390/jcm9030659
[7] M. Ragni, P. Golino, et al. Endogenous tissue factor pathway inhibitor modulates thrombus formation in an in vivo model of rabbit carotid artery stenosis and endothelial injury. Circulation, vol. 102, no. 1, p. 113-117, 2000. https://doi.org/10.1161/01.cir.102.1.113
[8] A. Kumar, K. Koenig, A. Johnson, D. Fair, & S. Idell. Inhibition of factor xa-mediated procoagulant activity of human lung fibroblasts and pleural mesothelial cells. European Respiratory Journal, vol. 8, no. 12, p. 2038-2045, 1995. https://doi.org/10.1183/09031936.95.08122038
[9] T. Geisbert, L. Hensley, et al. Treatment of ebola virus infection with a recombinant inhibitor of factor viia/tissue factor: a study in rhesus monkeys. The Lancet, vol. 362, no. 9400, p. 1953-1958, 2003. https://doi.org/10.1016/s0140-6736(03)15012-x
[10] P. Enkhbaatar, K. Okajima, et al. Recombinant tissue factor pathway inhibitor reduces lipopolysaccharide-induced pulmonary vascular injury by inhibiting leukocyte activation. American Journal of Respiratory and Critical Care Medicine, vol. 162, no. 5, p. 1752-1759, 2000. https://doi.org/10.1164/ajrccm.162.5.9911018
[11] J. Dennis, V. Trương, et al. Single nucleotide polymorphisms in an intergenic chromosome 2q region associated with tissue factor pathway inhibitor plasma levels and venous thromboembolism. Journal of Thrombosis and Haemostasis, vol. 14, no. 10, p. 1960-1970, 2016. https://doi.org/10.1111/jth.13431
[12] C. Duckers, P. Simioni, et al. Low plasma levels of tissue factor pathway inhibitor in patients with congenital factor v deficiency. Blood, vol. 112, no. 9, p. 3615-3623, 2008. https://doi.org/10.1182/blood-2008-06-162453
[13] S. Stojković, C. Kaun, et al. Tissue factor is induced by interleukin-33 in human endothelial cells: a new link between coagulation and inflammation. Scientific Reports, vol. 6, no. 1, 2016. https://doi.org/10.1038/srep25171

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : Western Blot

Review: We used the 35 kDa protein TFPI (CUSABIO, Wuhan, China) added with the His-tag as the control Subsequently, we detected the purified recombinant proteins by Western blot with anti-His and found that Chi2 and Chi14 were 44 KD and 37 KD, respectively.

By Anonymous

Target Background

Function
Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma.
Gene References into Functions
  1. plasma level not different between pre-eclampsia and normal pregnancy PMID: 28521572
  2. Patients with early onset preeclampsia are characterised by an attenuated coagulation response characterised by reduced thrombin generation stimulated by low-dose TF and elevated plasma TFPI activity. PMID: 28569919
  3. Developed functional protein S assays that measure both the activated protein C- and TFPI-cofactor activities of protein S in plasma, which are hardly if at all affected by the FV Leiden mutation. PMID: 28211163
  4. These data indicate that both isoforms of TFPI are present in advanced plaques and that anti-inflammatory M2 macrophages may be a potential source of TFPI. PMID: 28482260
  5. Among the various candidate genes involved in acute rejection, CD47 inhibits monocyte/macrophage-mediated phagocytosis by identifying the CD47 signal regulatory protein alpha (SIRP-alpha) as self/non-self. Tissue factor pathway inhibitor (TFPI) is involved in the regulation of the coagulation pathway and is able to bind to another ligand of CD47, thrombospondin-1 (TSP-1). PMID: 28393401
  6. Tissue Factor Pathway Inhibitor Gene Polymorphism is associated with response to therapy in Colorectal Cancer. PMID: 26968713
  7. For the first time, we show that a TFPI variant is significantly associated with fibrinogen levels and risk of coronary artery disease. PMID: 28894953
  8. miR-27a/b and miR-494 regulate TFPIalpha expression; there may be a role of these miRNAs in the estrogen-mediated downregulation of TFPIalpha PMID: 26999003
  9. Genetic variations of the TFPI genes seem to be related with coronary artery disease, which likely cooperate with metabolic risk factor (diabetes mellitus) and play critical roles in the pathogenesis of coronary artery disease in Han Chinese. PMID: 28716011
  10. Cleavage of FV at Arg(1545) , which abolishes the anticoagulant properties of FV and commits FV to the procoagulant pathway, is inhibited by binding of the TFPIalpha C-terminus to the FV acidic region PMID: 27801970
  11. The aim of this study was to evaluate the concentration of TF and its inhibitor TFPI in blood plasma, the impact of traditional and non-traditional cardiovascular risk factors on their concentration and the impact of both markers of haemostasis on the severity of subclinical atherosclerosis. PMID: 28749986
  12. The results show that cholesterol crystals induce TFPI and cytokine expression in M2-polarized macrophages through activation of the endoplasmic reticulum stress pathway and that TFPI has a protective effect against TNF-alpha and IL-6 mediated inflammation. PMID: 28712870
  13. Among high-risk women, the tissue factor pathway inhibitor activity of patients with gestational vascular complications is higher than that in other patients. Hence, these markers could augment a screening strategy. PMID: 28328938
  14. TFPI single nucleotide polymorphism is associated with venous thromboembolism. PMID: 28421636
  15. a concentration of tissue factor pathway inhibitor was significantly lower in patients with essential thrombocythemia with JAK2 V617F mutation as compared with patients without the mutation PMID: 26945263
  16. This review presents a comprehensive understanding of TFPI structure, biochemistry, and cellular expression which is necessary to understand how it modulates bleeding in hemophilia and the physiological impact of therapeutic agents targeting TFPI. PMID: 27207418
  17. the main finding of the current study is the remarkable elevation in the plasma levels of both total and free TFPI in septic patients at baseline. The levels of both forms of the inhibitor remained elevated throughout the first 24 h with further elevation after enoxaparin administration. PMID: 26377606
  18. TFPI-1 was a valuable predictor of deep venous thrombosis and tumor metastasis in non-small cell lung cancer patients. PMID: 28246607
  19. Circulating FVII, FVIIa and TFPI were significantly elevated in women with severe preeclampsia in the absence of comparable changes in plasma TF levels. PMID: 26765308
  20. HIF-1alpha is involved in the transcriptional regulation of the TFPI gene, and suggests that a hypoxic microenvironment inside a breast tumor may induce a procoagulant state in breast cancer patients. PMID: 26598923
  21. ERalpha can interact with all three ERE half-sites in the TFPI 5'-flanking region. PMID: 26999742
  22. rs5940 and rs7586970 moderate TFPI plasma levels and are candidate risk factors for thrombosis, but the regulation of TFPI plasma levels involves genetic factors beyond the TFPI gene. Review. PMID: 25879386
  23. Tissue factor pathway inhibitor activity and APC resistance are related to coronary heart disease risk in women, but may not explain the increased CHD risk due to estrogen plus progestin therapy. PMID: 26681757
  24. Association between genetic polymorphisms and deep vein thrombosis in a Chinese population. PMID: 26233570
  25. coagulation system, TFPI play an important role in the pathogenesis of CRSwNP. PMID: 26163243
  26. A significant degradation of TFPI was induced by ROS exposure, resulting in a decreased ability to bind FXa. ROS induce a procoagulant state in endothelial cells by altering TFPI structure, resulting in inhibition of TFPI binding to Factor Xa PMID: 25712553
  27. TNFalpha and Stx-1 compared to TNFalpha alone leads to an increase in procoagulant TF on endothelial cells, which is explained by a significant decrease in TFPI not co-localized with TF and not to an increase in TF not co-localized with TFPI PMID: 25864889
  28. Direct inhibition of FXa by TFPIalpha inhibits thrombin generation and contributes to the downregulation of coagulation. PMID: 25348176
  29. Tissue factor pathway inhibitor-2 gene polymorphisms were associated with coronary atherosclerosis in the Chinese population PMID: 26496276
  30. This study indicates that genetic and phenotypic variation of both TFPIalpha and TFPIbeta, more than TF, are markers of cancer progression. PMID: 25882602
  31. Syndecan-3 and TFPI colocalize on the surface of endothelial-, smooth muscle-, and cancer cells PMID: 25617766
  32. Describe inhibition of tissue factor:factor VIIa-catalyzed factor IX and factor X activation by TFPI and TFPI constructs. PMID: 25163770
  33. Neither genetic polymorphisms nor the plasma levels of TFPI seem to act as direct risk factors for venous thromboembolism. PMID: 24448154
  34. Thrombin decreases TFPI expression in human pleural mesothelial cells. PMID: 25303460
  35. Colon TFPI levels are increased in ulcerative colitis. PMID: 24966616
  36. TFPI inhibits lectin pathway of complement activation by direct interaction with MASP-2. PMID: 25359215
  37. Most capillary endothelial cells of the cholecystitis group presented weak expression for TFPI. PMID: 24716194
  38. TFPI is an early biomarker in myocardial infarct and may explain the final infarct size. PMID: 24461489
  39. genetic polymorphism affects endogenous thrombin potential among FV Leiden carriers PMID: 24226152
  40. Data indicate that the protein S sex hormone-binding globulin (SHBG)-like domain was important for binding and enhancement of tissue factor pathway inhibitor (TFPI). PMID: 24740810
  41. Studies indicate differential expression of tissue factor pathway inhibitor isoforms TFPIalpha and TFPIbeta in platelets and endothelial cells. PMID: 24620349
  42. TFPI mRNA expression was increased in clear cell carcinoma (P<0.01). PMID: 24094893
  43. Both the protein S and the TFPI ratios were increased in patients with cirrhosis compared to controls. PMID: 23841464
  44. Small peptides blocking inhibition of factor Xa and tissue factor-factor VIIa by tissue factor pathway inhibitor (TFPI). PMID: 24275667
  45. Demonstrate a 5' untranslated region alternative splicing event that alters translation of TFPI isoforms produced via independent 3' splicing events within the same gene. PMID: 24233486
  46. PS exerts anticoagulant cofactor activity with TFPIalpha from any physiological pool, likely by localizing TFPIalpha to membrane surfaces, stabilizing its interaction with membrane-bound FXa, and slowing thrombin generation. PMID: 24233490
  47. Tissue factor pathway inhibitor-alpha inhibits prothrombinase during the initiation of blood coagulation. PMID: 24127605
  48. The east Texas bleeding disorder-associated F5(A2440G) mutations leads to the formation of the TFPIalpha:FV-short complex, which inhibits activation and propagation of coagulation. PMID: 23979162
  49. The effect of oral contraceptives on TFPI and PS is a possible explanation for the increased risk of venous thrombosis associated with oral contraceptives. PMID: 23407778
  50. tissue factor pathway inhibitor has a role in coagulation in hemostasis, particularly when FVIII is missing PMID: 23348798

Show More

Hide All

Subcellular Location
[Isoform Alpha]: Secreted.; [Isoform Beta]: Microsome membrane; Lipid-anchor, GPI-anchor.
Tissue Specificity
Mostly in endothelial cells.
Database Links

HGNC: 11760

OMIM: 152310

KEGG: hsa:7035

STRING: 9606.ENSP00000233156

UniGene: Hs.516578

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*