Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human ZG16B at 2 μg/mL can bind Anti-ZG16B recombinant antibody (CSB-RA836195MA1HU), the EC50 is 24.13-46.04 ng/mL.
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
53-208aa
Target Protein Sequence
GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
This Human ZG16B recombinant protein was produced in mammalian cell, where the gene sequence encoding Human ZG16B (53-208aa) was expressed with the C-terminal 10xHis tag. The purity of this ZG16B protein was greater than 95% by SDS-PAGE. The activity was validated in functional ELISA.
ZG16B was first found to be highly expressed in pancreatic cancer and plays an important role in carcinogenesis, and was named as pancreatic cancer-related up-regulator PAUF. The latest research results show that ZG16B plays its role as an oncogene by up-regulating the expression and transcriptional activity of β-catenin in pancreatic cancer. At the same time, other studies have also found that ZG16B is not only highly expressed in pancreatic cancer, but also in colon cancer. It is also highly expressed in ovarian cancer, gastric cancer and other cancer tissues. Furthermore, ZG16B plays an important role in cancer progression such as cell proliferation, adhesion, migration, and invasion. However, in colon cancer, whether ZG16B plays a role in cancer by upregulating the expression and transcriptional activity of β-catenin and activating the Wnt/β-catenin signaling pathway is still unknown. As a novel activator of human endothelial cells, ZG16B has similar effects to vascular endothelial growth factor (VEGF), which can promote angiogenesis and increase vascular permeability in vitro and in vivo.
