Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
ZG16B; UNQ773/PRO1567Zymogen granule protein 16 homolog B
Species
Homo sapiens (Human)
Expression Region
53-208aa
Target Protein Sequence
GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 53-208 form the expressed segment for recombinant Human ZG16B. The calculated molecular weight for this ZG16B protein is 21.2 kDa. This protein is generated in a e.coli-based system. Fusion of the N-terminal 6xHis tag into the ZG16B encoding gene fragment was conducted, allowing for easier detection and purification of the ZG16B protein in subsequent stages.
Human zymogen granule protein 16 homolog B (ZG16B) is primarily involved in endoplasmic reticulum-associated protein degradation (ERAD). Its main function centers around recognizing and guiding misfolded proteins for degradation, contributing to cellular quality control. In the realm of cellular and molecular research, the study of ZG16B offers valuable insights into the mechanisms governing protein quality control and ERAD processes. Given its association with digestive disorders and inflammatory responses, ZG16B holds significance in gastrointestinal research. Investigating ZG16B provides potential applications in unraveling protein homeostasis, understanding ER stress responses, and exploring therapeutic strategies for conditions related to protein misfolding and degradation.
