Recombinant Human Zymogen granule protein 16 homolog B (ZG16B)

In Stock
Code CSB-EP836195HU
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
ZG16B
Uniprot No.
Research Area
Immunology
Alternative Names
ZG16B; UNQ773/PRO1567Zymogen granule protein 16 homolog B
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
53-208aa
Target Protein Sequence
GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
21.2kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 53-208 form the expressed segment for recombinant Human ZG16B. The calculated molecular weight for this ZG16B protein is 21.2 kDa. This protein is generated in a e.coli-based system. Fusion of the N-terminal 6xHis tag into the ZG16B encoding gene fragment was conducted, allowing for easier detection and purification of the ZG16B protein in subsequent stages.

Human zymogen granule protein 16 homolog B (ZG16B) is primarily involved in endoplasmic reticulum-associated protein degradation (ERAD). Its main function centers around recognizing and guiding misfolded proteins for degradation, contributing to cellular quality control. In the realm of cellular and molecular research, the study of ZG16B offers valuable insights into the mechanisms governing protein quality control and ERAD processes. Given its association with digestive disorders and inflammatory responses, ZG16B holds significance in gastrointestinal research. Investigating ZG16B provides potential applications in unraveling protein homeostasis, understanding ER stress responses, and exploring therapeutic strategies for conditions related to protein misfolding and degradation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. we conclude that the PAUF is a powerful and multifunctional promoter of tumor growth through increase and functional activation of myeloid-derived suppressor cells PMID: 27322081
  2. Mouse DCPP1 is a multifunctional promoter of tumor growth through functional activation of pancreatic cancer cells, suggesting it to be an ortholog of human PAUF. PMID: 28988106
  3. Our results suggest that PAUF has tumour-promoting functions in oral squamous cell carcinoma PMID: 27706833
  4. High PAUF expression is associated with resistance to gemcitabine in pancreatic cancer. PMID: 26684804
  5. PAUF mediated dendritic cell activation and immune stimulation are dependent on TLR4 PMID: 26336989
  6. constitutive suppression of PAUF sensitized Bxpc3 pancreatic cancer cells to oncolytic parvovirus H-1 infection PMID: 25727013
  7. PAUF rs12373A>C polymorphisms are associated with colorectal cancer. PMID: 25079514
  8. PAUF-siRNA inhibited the proliferation of colorectal cancer cells, promoted their apoptosis and induced G0/G1 cell cycle arrest. At the same time, PAUF-siRNA inhibited the invasion, adhesion and migration of the tumor cells. PMID: 23677445
  9. new possibilities for PAUF's role in the pathogenesis of angiogenesis-dependent diseases PMID: 22907431
  10. activation of SIRT1 inhibited the proliferation of pancreatic cancer -PAUF cells by down-regulation of cyclin-D1, a target molecule of beta-catenin. PMID: 22640743
  11. PAUF-mediated FAK activation plays an important role in pancreatic cancer progression. PMID: 21464589
  12. PAUF can up-regulate and stabilize beta-catenin via a novel pattern of phosphorylation, thereby contributing to the rapid proliferation of pancreatic cancer cells. PMID: 21196815
  13. Data demonstrate that the host salivary protein CSP-1 (HRPE773 GenBank AAQ89380.1) binds to S. mutans cells and may influence the initial colonization of this pathogenic bacterium onto the tooth surface. PMID: 20858015
  14. the sugar-binding site and the adjacent basic patch of ZG16p and ZG16b cooperatively form a functional glycosaminoglycan-binding site. PMID: 21110947
  15. PAUF is a mammalian lectin normally found in plant lectins. PAUF induces extracellular signal-regulated kinase phosphorylation and activates the IKK-b-mediated TPL2/MEK/ERK signaling pathway through TLR2. PMID: 20802527
  16. Findings indicate that PAUF enhances the metastatic potential of pancreatic cancer cells, at least in part, by upregulating CXCR4 expression. PMID: 19784070
  17. Bioinformatic analysis identified a putative human CSP-1/Dcpp ortholog, HRPE773, expressed predominantly in human salivary tissue, that shows 31% amino acid identity and 45% amino acid similarity to the mouse Dcpp query sequence. PMID: 16954406
  18. pancreatic adenocarcinoma up-regulated factor was secreted into the culture medium of pancreatic adenocarcinoma up-regulated factor-overexpressing Chinese hamster ovary cells, had an apparent molecular mass of approximately 25 kDa, and was N-glycosylated PMID: 19302292

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Jacalin lectin family
Database Links

HGNC: 30456

KEGG: hsa:124220

STRING: 9606.ENSP00000371715

UniGene: Hs.105887

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*