Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

ZG16B

Uniprot No.

Q96DA0

Research Area

Immunology

Alternative Names

ZG16B; UNQ773/PRO1567Zymogen granule protein 16 homolog B

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

53-208aa

Target Protein Sequence

GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

21.2kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 53-208 form the expressed segment for recombinant Human ZG16B. The calculated molecular weight for this ZG16B protein is 21.2 kDa. This protein is generated in a e.coli-based system. Fusion of the N-terminal 6xHis tag into the ZG16B encoding gene fragment was conducted, allowing for easier detection and purification of the ZG16B protein in subsequent stages.

Human zymogen granule protein 16 homolog B (ZG16B) is primarily involved in endoplasmic reticulum-associated protein degradation (ERAD). Its main function centers around recognizing and guiding misfolded proteins for degradation, contributing to cellular quality control. In the realm of cellular and molecular research, the study of ZG16B offers valuable insights into the mechanisms governing protein quality control and ERAD processes. Given its association with digestive disorders and inflammatory responses, ZG16B holds significance in gastrointestinal research. Investigating ZG16B provides potential applications in unraveling protein homeostasis, understanding ER stress responses, and exploring therapeutic strategies for conditions related to protein misfolding and degradation.

Target Background

Gene References into Functions

we conclude that the PAUF is a powerful and multifunctional promoter of tumor growth through increase and functional activation of myeloid-derived suppressor cells PMID: 27322081
Mouse DCPP1 is a multifunctional promoter of tumor growth through functional activation of pancreatic cancer cells, suggesting it to be an ortholog of human PAUF. PMID: 28988106
Our results suggest that PAUF has tumour-promoting functions in oral squamous cell carcinoma PMID: 27706833
High PAUF expression is associated with resistance to gemcitabine in pancreatic cancer. PMID: 26684804
PAUF mediated dendritic cell activation and immune stimulation are dependent on TLR4 PMID: 26336989
constitutive suppression of PAUF sensitized Bxpc3 pancreatic cancer cells to oncolytic parvovirus H-1 infection PMID: 25727013
PAUF rs12373A>C polymorphisms are associated with colorectal cancer. PMID: 25079514
PAUF-siRNA inhibited the proliferation of colorectal cancer cells, promoted their apoptosis and induced G0/G1 cell cycle arrest. At the same time, PAUF-siRNA inhibited the invasion, adhesion and migration of the tumor cells. PMID: 23677445
new possibilities for PAUF's role in the pathogenesis of angiogenesis-dependent diseases PMID: 22907431
activation of SIRT1 inhibited the proliferation of pancreatic cancer -PAUF cells by down-regulation of cyclin-D1, a target molecule of beta-catenin. PMID: 22640743
PAUF-mediated FAK activation plays an important role in pancreatic cancer progression. PMID: 21464589
PAUF can up-regulate and stabilize beta-catenin via a novel pattern of phosphorylation, thereby contributing to the rapid proliferation of pancreatic cancer cells. PMID: 21196815
Data demonstrate that the host salivary protein CSP-1 (HRPE773 GenBank AAQ89380.1) binds to S. mutans cells and may influence the initial colonization of this pathogenic bacterium onto the tooth surface. PMID: 20858015
the sugar-binding site and the adjacent basic patch of ZG16p and ZG16b cooperatively form a functional glycosaminoglycan-binding site. PMID: 21110947
PAUF is a mammalian lectin normally found in plant lectins. PAUF induces extracellular signal-regulated kinase phosphorylation and activates the IKK-b-mediated TPL2/MEK/ERK signaling pathway through TLR2. PMID: 20802527
Findings indicate that PAUF enhances the metastatic potential of pancreatic cancer cells, at least in part, by upregulating CXCR4 expression. PMID: 19784070
Bioinformatic analysis identified a putative human CSP-1/Dcpp ortholog, HRPE773, expressed predominantly in human salivary tissue, that shows 31% amino acid identity and 45% amino acid similarity to the mouse Dcpp query sequence. PMID: 16954406
pancreatic adenocarcinoma up-regulated factor was secreted into the culture medium of pancreatic adenocarcinoma up-regulated factor-overexpressing Chinese hamster ovary cells, had an apparent molecular mass of approximately 25 kDa, and was N-glycosylated PMID: 19302292

Hide All

Subcellular Location

Secreted.

Protein Families

Jacalin lectin family

Database Links

HGNC: 30456

KEGG: hsa:124220

STRING: 9606.ENSP00000371715

UniGene: Hs.105887

Code	CSB-EP836195HU
Abbreviation	Recombinant Human ZG16B protein
MSDS	MSDS Datasheet
Size	US$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Pancreatic adenocarcinoma up-regulated factor (ZG16B)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage