Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis GIPR at 2 μg/mL can bind Anti-GIPR recombinant antibody (CSB-RA009438MA1HU). The EC50 is 12.66-13.86 ng/mL.

Target Names

GIPR

Uniprot No.

A0A2K5VD75

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source

yeast

Expression Region

26-138aa

Target Protein Sequence

GSEGQTAGELYQRWERYRRECQETLATAEPPSGLACNGSFDMYVCWNYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ

Mol. Weight

14.5 kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl,0.5 M NaCl,250mM Imidazole 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

GIPR mediates the insulinotropic effects of glucose-dependent insulinotropic polypeptide and represents a validated target in metabolic disease research, yet reliable extracellular domain constructs for antibody screening remain scarce. This yeast-expressed fragment spanning residues 26–138 captures the N-terminal ligand-binding region and demonstrates quantifiable antibody recognition in functional ELISA, binding an anti-GIPR recombinant antibody with an EC50 of 12.66–13.86 ng/mL—a result that supports its use in therapeutic antibody epitope mapping, competitive inhibition assays, and blocking antibody screening campaigns. The construct carries an N-terminal 6xHis tag to facilitate oriented immobilization in surface plasmon resonance and biolayer interferometry experiments for affinity characterization of candidate biologics. Purity exceeding 95% by SDS-PAGE and endotoxin below 1.0 EU/μg align with standards expected in ligand-binding assays and antibody validation workflows where low background interference is critical.

Code	CSB-YP4825MOV
Abbreviation	Recombinant Cynomolgus monkey GIPR protein, partial (Active)
MSDS	MSDS Datasheet
Size	$9.9
Promotion
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis GIPR at 2μg/mL can bind Anti-GIPR recombinant antibody (CSB-RA009438MA1HU)，the EC₅₀ is 12.66-13.86 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Macaca fascicularis Gastric inhibitory polypeptide receptor (GIPR), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

×CloseMessage