Recombinant Macaca fascicularis Gastric inhibitory polypeptide receptor (GIPR), partial (Active)

In Stock
Code CSB-YP4825MOV
Abbreviation Recombinant Cynomolgus monkey GIPR protein, partial (Active)
MSDS
Size $368
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156 Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis GIPR at 2 μg/mL can bind Anti-GIPR recombinant antibody (CSB-RA009438MA1HU). The EC50 is 12.66-13.86 ng/mL.
Target Names
Uniprot No.
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
yeast
Expression Region
26-138aa
Target Protein Sequence
GSEGQTAGELYQRWERYRRECQETLATAEPPSGLACNGSFDMYVCWNYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ
Mol. Weight
14.5 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl,0.5 M NaCl,250mM Imidazole 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This active recombinant Macaca fascicularis gastric inhibitory polypeptide receptor (GIPR) fragment (amino acid residues 26-138) is expressed in yeast with an N-terminal 6×His tag, achieving high purity (>95% by SDS-PAGE) and low endotoxin levels (<1.0 EU/μg, LAL method). Functional validation demonstrates specific binding to anti-GIPR recombinant antibody (CSB-RA009438MA1HU) in ELISA, with the EC50 of 12.66–13.86 ng/mL, confirming proper folding and antigenic competence. Its lyophilized form facilitates enhanced stability and is convenient for storage and transportation. The His tag ensures efficient purification without disrupting ligand-binding domains. This GIPR protein is valuable for probing GIPR's function in energy homeostasis and β-cell biology.

The GIPR protein, known for its role in glucose metabolism regulation, has been studied within various species, including Macaca fascicularis (cynomolgus macaque). GIPR functions primarily as a receptor for the endogenous hormone, gastric inhibitory peptide (GIP), which is implicated in insulin secretion and appetite regulation. This modulation is crucial as it complements the effects of incretin hormones, thus influencing glucose levels and energy homeostasis [1].

In Macaca fascicularis, the GIPR protein exhibits similarities with its counterparts in other primate species. For instance, research has demonstrated that nonhuman primates like the cynomolgus macaque provide a relevant model for studying obesity and diabetes due to their physiological responses akin to humans [2]. This genetic and physiological proximity offers valuable insights into alterations in GIPR signaling that could manifest in metabolic disorders.

Moreover, the role of GIPR in the context of immune responses has begun to gain attention. It has been suggested that beyond its metabolic functions, GIPR may also interact with various immune pathways, intersecting with the functions of different cytokines and chemokines present in the immune response [2][3]. This is particularly relevant, as immune modulation could influence the pathophysiological conditions in which GIPR might be involved, such as chronic inflammation or cancer, given the shared pathways between metabolism and immune functionality [4][1].

Most importantly, studies have indicated that variations in GIPR may contribute to the differences observed in glucose metabolism and susceptibility to diabetes among primate species. In the specific context of Macaca fascicularis, its GIPR structure and function underline its potential as a therapeutic target for managing diabetes. Research utilizing cynomolgus macaques in drug development has shown that a detailed understanding of genetic expressions and variability can lead to better-focused interventions for human diseases [5][6].

References:
[1] S. Kanthaswamy, J. Ng, et al. The genetic composition of populations of cynomolgus macaques (macaca fascicularis) used in biomedical research. Journal of Medical Primatology, vol. 42, no. 3, p. 120-131, 2013. https://doi.org/10.1111/jmp.12043
[2] J. Estes, S. Wong, & J. Brenchley,. Nonhuman primate models of human viral infections. Nature Reviews Immunology, vol. 18, no. 6, p. 390-404, 2018. https://doi.org/10.1038/s41577-018-0005-7
[3] D. Vanderpool, B. Minh, et al. Primate phylogenomics uncovers multiple rapid radiations and ancient interspecific introgression. Plos Biology, vol. 18, no. 12, p. e3000954, 2020. https://doi.org/10.1371/journal.pbio.3000954
[4] H. Darusman, S. Mariya, et al. Spontaneous expression of the gene of ki67 and p53 in cynomolgus monkeys infected with papillomavirus. Veterinary World, p. 962-967, 2022. https://doi.org/10.14202/vetworld.2022.962-967
[5] S. Mariya, F. Dewi, et al. Isolation and characterization of c-c chemokine ligand 7 (ccl7) in cynomolgus macaques. Hayati Journal of Biosciences, vol. 26, no. 3, p. 129, 2019. https://doi.org/10.4308/hjb.26.3.129
[6] J. Uli, C. Yong, et al. Rna sequencing (rna-seq) of lymph node, spleen, and thymus transcriptome from wild peninsular malaysian cynomolgus macaque (macaca fascicularis). Peerj, vol. 5, p. e3566, 2017. https://doi.org/10.7717/peerj.3566

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*