Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis MICB at 2 μg/mL can bind Anti-MICA/B recombinant antibody (CSB-RA56059MA1HU). The EC50 is 1.578-1.831 ng/mL.

Target Names

MICB

Uniprot No.

UJY53393.1

Alternative Names

/

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source

Mammalian cell

Expression Region

30-297aa

Target Protein Sequence

AELHSLRYNVTVLSRDGSVQSGFLAEGHLDGQLFVRYDRETRRARPQGQWAEAVLGDQETEDLTENAQDLRRTLTHIEGQKGGLHSLQKIKICEIYEDGSTGGFWHFYYDGELFLSLNLETQKWTVAQSSRAQTLAMSFWKEDTMKTNTHYRAMRADCLKKLRRYQKSRVAVRRTVPPMVNVTHGEASEGNITVTCRASGFYPGNITLTWRQDGVSLSHDAQQWGDVLPDRNGTYYTWVATRIRQGEEQKFACYMEHSGNHSTHPVPS

Mol. Weight

32.0 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

MICB serves as a stress-induced ligand for NKG2D receptors on natural killer and T cells, making it a critical target for understanding immune surveillance in non-human primate models. This protein, spanning residues 30–297 and expressed in mammalian cells to preserve native glycosylation and disulfide bonding, demonstrates quantifiable binding to anti-MICA/B antibodies with an EC50 of 1.578–1.831 ng/mL in functional ELISA, confirming conformational integrity suitable for receptor-ligand interaction studies and therapeutic antibody epitope mapping. The validated binding activity supports competitive inhibition assays, blocking antibody screening, and affinity characterization by surface plasmon resonance or biolayer interferometry in cynomolgus macaque immunology research. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for cell-based functional assays and antibody validation workflows in immune checkpoint and NK cell biology investigations.

Code	CSB-MP6584MOV(A4)
Abbreviation	Recombinant Cynomolgus monkey MICB protein, partial (Active)
MSDS	MSDS Datasheet
Size	$126
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis MICB at 2 μg/ml can bind Anti-MICA/B recombinant antibody (CSB-RA56059MA1HU). The EC₅₀ is 1.578-1.831 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Macaca fascicularis MHC class I polypeptide-related sequence B (MICB), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

×CloseMessage