Recombinant Macaca fascicularis MHC class I polypeptide-related sequence B (MICB), partial (Active)

In Stock
Code CSB-MP6584MOV(A4)
Abbreviation Recombinant Cynomolgus monkey MICB protein, partial (Active)
MSDS
Size $126
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis MICB at 2 μg/ml can bind Anti-MICA/B recombinant antibody (CSB-RA56059MA1HU). The EC50 is 1.578-1.831 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis MICB at 2 μg/mL can bind Anti-MICA/B recombinant antibody (CSB-RA56059MA1HU). The EC50 is 1.578-1.831 ng/mL.
Target Names
Uniprot No.
Alternative Names
/
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
Mammalian cell
Expression Region
30-297aa
Target Protein Sequence
AELHSLRYNVTVLSRDGSVQSGFLAEGHLDGQLFVRYDRETRRARPQGQWAEAVLGDQETEDLTENAQDLRRTLTHIEGQKGGLHSLQKIKICEIYEDGSTGGFWHFYYDGELFLSLNLETQKWTVAQSSRAQTLAMSFWKEDTMKTNTHYRAMRADCLKKLRRYQKSRVAVRRTVPPMVNVTHGEASEGNITVTCRASGFYPGNITLTWRQDGVSLSHDAQQWGDVLPDRNGTYYTWVATRIRQGEEQKFACYMEHSGNHSTHPVPS
Mol. Weight
32.0 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

MICB serves as a stress-induced ligand for NKG2D receptors on natural killer and T cells, making it a critical target for understanding immune surveillance in non-human primate models. This protein, spanning residues 30–297 and expressed in mammalian cells to preserve native glycosylation and disulfide bonding, demonstrates quantifiable binding to anti-MICA/B antibodies with an EC50 of 1.578–1.831 ng/mL in functional ELISA, confirming conformational integrity suitable for receptor-ligand interaction studies and therapeutic antibody epitope mapping. The validated binding activity supports competitive inhibition assays, blocking antibody screening, and affinity characterization by surface plasmon resonance or biolayer interferometry in cynomolgus macaque immunology research. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for cell-based functional assays and antibody validation workflows in immune checkpoint and NK cell biology investigations.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*