Recombinant Macaca mulatta Tumor necrosis factor ligand superfamily member 15 (TNFSF15), partial, Biotinylated (Active)

In Stock
Code CSB-MP5305MOW-B
Abbreviation Recombinant Rhesus macaque TNFSF15 protein, partial, Biotinylated (Active)
MSDS
Size $164
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Anti-TNFSF15 recombinant antibody (CSB-RA023992MA1HU) at 2 μg/ml can bind Biotinylated Macaca mulatta TNFSF15. The EC50 is 0.2589-0.3025 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Anti-TNFSF15 recombinant antibody (CSB-RA023992MA1HU) at 2 μg/mL can bind Biotinylated Macaca mulatta TNFSF15. The EC50 is 0.2589-0.3025 ng/mL.
Target Names
Uniprot No.
Alternative Names
TNF superfamily member 15; Tumor necrosis factor ligand 1B
Species
Macaca mulatta (Rhesus macaque)
Source
Mammalian cell
Expression Region
72-251aa
Target Protein Sequence
LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHLKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFVYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Mol. Weight
25.3 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-Avi-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

TNFSF15 mediates inflammatory signaling through death receptor 3 and plays a central role in mucosal immunity and tumor microenvironment modulation, making the rhesus macaque ortholog essential for translational primate models of inflammatory bowel disease and cancer immunotherapy. This biotinylated variant, spanning residues 72–251 of the mature extracellular domain, demonstrates robust receptor engagement with an EC50 of 0.26–0.30 ng/mL in functional ELISA against an anti-TNFSF15 antibody, providing quantitative evidence of native-like binding competence suitable for antibody development, ELISA standardization, and receptor–ligand interaction studies. The N-terminal Avi-tag enables site-specific biotinylation for use in pull-down assays, surface plasmon resonance, and flow cytometry–based receptor profiling on primary macaque T cells or dendritic cells. Endotoxin levels below 1.0 EU/μg and purity exceeding 95% meet the quality thresholds commonly required for cell-based functional assays where LPS contamination would confound NF-κB or MAPK pathway readouts, supporting applications in macaque PBMC activation, cytokine secretion profiling, and in vivo inflammation models.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*