Recombinant Macaca mulatta Tumor necrosis factor ligand superfamily member 15 (TNFSF15), partial, Biotinylated (Active)

In Stock
Code CSB-MP5305MOW-B
Abbreviation Recombinant Rhesus macaque TNFSF15 protein, partial, Biotinylated (Active)
MSDS
Size $164
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Anti-TNFSF15 recombinant antibody (CSB-RA023992MA1HU) at 2 μg/ml can bind Biotinylated Macaca mulatta TNFSF15. The EC50 is 0.2589-0.3025 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Anti-TNFSF15 recombinant antibody (CSB-RA023992MA1HU) at 2 μg/mL can bind Biotinylated Macaca mulatta TNFSF15. The EC50 is 0.2589-0.3025 ng/mL.
Target Names
Uniprot No.
Alternative Names
TNF superfamily member 15; Tumor necrosis factor ligand 1B
Species
Macaca mulatta (Rhesus macaque)
Source
Mammalian cell
Expression Region
72-251aa
Target Protein Sequence
LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHLKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFVYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Mol. Weight
25.3 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-Avi-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Macaca fascicularis TNFSF15 protein is a biologically active, biotinylated construct produced in a mammalian expression system to ensure proper folding and post-translational modification. It consists of amino acids 72 to 251 of the TNFSF15 protein and includes an N-terminal 10xHis-Avi tag to support efficient purification and site-specific biotinylation. Supplied as a lyophilized powder, the recombinant TNFSF15 protein demonstrates high purity, exceeding 95% as confirmed by SDS-PAGE. Endotoxin content is strictly regulated, measuring below 1.0 EU/μg by the LAL assay. Functional validation in a binding ELISA shows that biotinylated TNFSF15 binds specifically to immobilized anti-TNFSF15 recombinant antibody (CSB-RA023992MA1HU) at 2 μg/mL, with an EC50 ranging from 0.2589 to 0.3025 ng/mL. These attributes make it a dependable reagent for studying TNFSF15-related signaling, immune response pathways, and therapeutic antibody interactions.

The TNFSF15 protein plays a significant role in various biological processes in Macaca fascicularis, specifically concerning angiogenesis, immune modulation, and cellular apoptosis. TNFSF15 is primarily expressed by endothelial cells and functions as a crucial regulator of vascular homeostasis and inflammatory responses.

One of the key functions of TNFSF15 is its ability to modulate angiogenesis. Studies have shown that TNFSF15 acts as an endogenous inhibitor of neovascularization, thus maintaining vascular stability. This is particularly important in conditions where abnormal vascular growth could be harmful, such as in tumors or diabetic retinopathy [1][2]. For instance, TNFSF15 inhibits the proliferation of endothelial cells while inducing apoptosis in rapidly proliferating cells, a mechanism essential for proper vascular remodeling during angiogenesis [1][2]. Furthermore, TNFSF15 facilitates the differentiation and polarization of macrophages towards the M1 phenotype, enhancing their capacity to inhibit tumor growth and modulate immune responses [3].

Additionally, TNFSF15 has been implicated in the regulation of lymphangiogenesis by upregulating VEGFR3 gene expression in lymphatic endothelial cells [4]. The interaction of TNFSF15 with various signaling pathways, including those mediated by STAT transcription factors, highlights its relevance in both promoting inflammatory responses and acting as a tumor suppressor [5]. LITAF, in particular, is recognized for its role in the pro-inflammatory signaling cascade and has been noted to exert inhibitory effects on tumor growth in conjunction with TNFSF15 [5].

Moreover, TNFSF15 demonstrates protective qualities against conditions such as diabetic retinopathy by inhibiting breakdown of the blood-retinal barrier, which is critical for maintaining retinal health. This protective mechanism involves the preservation of tight junction proteins within retinal endothelial cells, showcasing TNFSF15's potential as a therapeutic target in diabetic conditions [6].

In terms of its genetic underpinnings, the variability within the TNFSF15 gene, particularly polymorphisms like rs4979462, has been linked to altered expression levels and susceptibility to various diseases, including inflammatory bowel diseases and certain cancers, indicating its influence on the immune system [7][8]. The expression and function of TNFSF15 thus exemplify its multifaceted role in modulating both local and systemic responses in health and disease within Macaca fascicularis and possibly across other species.

References:
[1] W. Deng, X. Gu, et al. Down-modulation of tnfsf15 in ovarian cancer by vegf and mcp-1 is a pre-requisite for tumor neovascularization. Angiogenesis, vol. 15, no. 1, p. 71-85, 2011. https://doi.org/10.1007/s10456-011-9244-y
[2] Z. Zhang and L. Li. Tnfsf15 modulates neovascularization and inflammation. Cancer Microenvironment, vol. 5, no. 3, p. 237-247, 2012. https://doi.org/10.1007/s12307-012-0117-8
[3] C. Zhao, Q. Han, et al. Tnfsf15 facilitates differentiation and polarization of macrophages toward m1 phenotype to inhibit tumor growth. Oncoimmunology, vol. 11, no. 1, 2022. https://doi.org/10.1080/2162402x.2022.2032918
[4] T. Qin, G. Xu, et al. Tumour necrosis factor superfamily member 15 (tnfsf15) facilitates lymphangiogenesis via up‐regulation of vegfr3 gene expression in lymphatic endothelial cells. The Journal of Pathology, vol. 237, no. 3, p. 307-318, 2015. https://doi.org/10.1002/path.4577
[5] J. Zhou, Y. Zhang, et al. Litaf and tnfsf15, two downstream targets of ampk, exert inhibitory effects on tumor growth. Oncogene, vol. 30, no. 16, p. 1892-1900, 2011. https://doi.org/10.1038/onc.2010.575
[6] F. Jiang, Q. Chen, et al. Tnfsf15 inhibits blood retinal barrier breakdown induced by diabetes. International Journal of Molecular Sciences, vol. 17, no. 5, p. 615, 2016. https://doi.org/10.3390/ijms17050615
[7] K. Jia and J. Shen. Transcriptome-wide association studies associated with crohn’s disease: challenges and perspectives. Cell & Bioscience, vol. 14, no. 1, 2024. https://doi.org/10.1186/s13578-024-01204-w
[8] A. Al-Danakh, M. Safi, et al. Aging-related biomarker discovery in the era of immune checkpoint inhibitors for cancer patients. Frontiers in Immunology, vol. 15, 2024. https://doi.org/10.3389/fimmu.2024.1348189

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*