Home
Active Protein
Other
Recombinant Macaca mulatta Tumor necrosis factor ligand superfamily member 15 (TNFSF15), partial (Active)

Recombinant Macaca mulatta Tumor necrosis factor ligand superfamily member 15 (TNFSF15), partial (Active)

^{In Stock} ^Promotion

Code	CSB-MP5305MOW
Abbreviation	Recombinant Rhesus macaque TNFSF15 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$9.9
Promotion
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Macaca mulatta TNFSF15 at 2 μg/ml can bind Anti-HSPA5 recombinant antibody (CSB-RA023992MA1HU). The EC₅₀ is 0.9216-1.128 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A

Product Details

Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Macaca mulatta TNFSF15 at 2 μg/mL can bind Anti-HSPA5 recombinant antibody (CSB-RA023992MA1HU). The EC50 is 0.9216-1.128 ng/mL.

Target Names

TNFSF15

Uniprot No.

F6S8F9

Alternative Names

Tumor necrosis factor ligand superfamily member 15; TNF ligand-related molecule 1; Vascular endothelial cell growth inhibitor

Species

Macaca mulatta (Rhesus macaque)

Source

Mammalian cell

Expression Region

72-251aa

Target Protein Sequence

LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHLKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFVYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Mol. Weight

23.2 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

TNFSF15 plays a critical role in vascular remodeling and immune regulation, making it a key target in cancer biology and inflammatory disease research. This rhesus macaque ortholog, spanning residues 72–251, demonstrates robust receptor-binding activity with an EC50 of 0.92–1.13 ng/mL in functional ELISA, confirming that the recombinant protein retains native signaling competence suitable for cell-based activation and apoptosis assays in primate-derived cell lines. The low endotoxin level (< 1.0 EU/μg) meets the quality thresholds commonly required for immune cell functional studies, where LPS contamination would confound readouts in NF-κB and MAPK pathway analyses. Purity exceeding 95% by SDS-PAGE, combined with the quantified binding potency, supports use of this protein as a coating antigen in antibody development workflows and as a positive control in cytokine detection platforms targeting the TNF superfamily.