Recombinant Macaca mulatta Tumor necrosis factor ligand superfamily member 15 (TNFSF15), partial (Active)

In Stock
Code CSB-MP5305MOW
Abbreviation Recombinant Rhesus macaque TNFSF15 protein, partial (Active)
MSDS
Size $136
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Macaca mulatta TNFSF15 at 2 μg/ml can bind Anti-HSPA5 recombinant antibody (CSB-RA023992MA1HU). The EC50 is 0.9216-1.128 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca mulatta TNFSF15 at 2 μg/mL can bind Anti-HSPA5 recombinant antibody (CSB-RA023992MA1HU). The EC50 is 0.9216-1.128 ng/mL.
Target Names
Uniprot No.
Alternative Names
Tumor necrosis factor ligand superfamily member 15; TNF ligand-related molecule 1; Vascular endothelial cell growth inhibitor
Species
Macaca mulatta (Rhesus macaque)
Source
Mammalian cell
Expression Region
72-251aa
Target Protein Sequence
LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHLKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFVYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Mol. Weight
23.2 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

TNFSF15 plays a critical role in vascular remodeling and immune regulation, making it a key target in cancer biology and inflammatory disease research. This rhesus macaque ortholog, spanning residues 72–251, demonstrates robust receptor-binding activity with an EC50 of 0.92–1.13 ng/mL in functional ELISA, confirming that the recombinant protein retains native signaling competence suitable for cell-based activation and apoptosis assays in primate-derived cell lines. The low endotoxin level (< 1.0 EU/μg) meets the quality thresholds commonly required for immune cell functional studies, where LPS contamination would confound readouts in NF-κB and MAPK pathway analyses. Purity exceeding 95% by SDS-PAGE, combined with the quantified binding potency, supports use of this protein as a coating antigen in antibody development workflows and as a positive control in cytokine detection platforms targeting the TNF superfamily.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*