Recombinant Macaca fascicularis natural cytotoxicity triggering receptor 3 ligand 1 (NCR3LG1), partial (Active)

In Stock
Code CSB-MP4942MOV
Abbreviation Recombinant Cynomolgus monkey NCR3LG1 protein, partial (Active)
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis NCR3LG1 at 5 μg/ml on an Nickel Coated plate can bind Macaca fascicularis NCR3(CSB-MP015551MOV1j8). The EC50 is 1.171-1.377 ng/mL. Biological Activity Assay
  • The purity of NCR3LG1 was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
≥ 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis NCR3LG1 at 5 μg/mL on an Nickel Coated plate can bind Macaca fascicularis NCR3(CSB-MP015551MOV1j8). The EC50 is 1.171-1.377 ng/mL.
Target Names
Uniprot No.
Alternative Names
/
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
Mammalian cell
Expression Region
25-259aa
Target Protein Sequence
DLKVEMMARGIQATRLNDSVTISCKVIYSQPLNITSMGITWFRKSLTLDKEVKVFEFFGDHQKAFRPGANVSLWRLKSGDASLKLPGVQLEEAGEYRCEVVVTPLKAQGTVQLKVVASPTSRLFQDQAVVKENEGKYMCESSRFYPKDINITWEKWTQKSPHHVVISENVITGPTIKNMDGTFNITSYLKLNSSQEDPGTVYRCVIRHESLHTPVSIDFILTAPQQSLSEPEKTD
Mol. Weight
27.9 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

NCR3LG1 serves as a ligand for the natural cytotoxicity receptor NKp30 (NCR3), modulating natural killer cell activation and cytotoxic responses in primate immune surveillance. This cynomolgus macaque ortholog, spanning residues 25–259, demonstrates robust receptor-binding activity with an EC50 of 1.171–1.377 ng/mL when paired with recombinant NCR3 in functional ELISA, providing quantitative evidence that supports its use in ligand-receptor interaction studies, competitive inhibition assays, and blocking antibody screening campaigns. Mammalian expression preserves the native glycosylation and disulfide architecture critical for conformational integrity, enabling reliable affinity characterization by surface plasmon resonance or biolayer interferometry in immune checkpoint research. The protein meets the purity and endotoxin criteria typical for therapeutic antibody epitope mapping and small-molecule inhibitor screening, with >95% purity by SDS-PAGE and <1.0 EU/μg endotoxin, aligning with standards expected in drug discovery workflows targeting NK cell-mediated immunity.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*