Recombinant Macaca mulatta Cytokine receptor common subunit gamma (IL2RG), partial (Active)

In Stock
Code CSB-MP2765MOW
Abbreviation Recombinant Rhesus macaque IL2RG protein, partial (Active)
MSDS
Size $118
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Rhesus macaque IL2RG at 2 μg/ml can bind Anti-IL2RG recombinant antibody (CSB-RA011651MA1HU). The EC50 is 33.73-41.04 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Rhesus macaque IL2RG at 2 μg/mL can bind Anti-IL2RG recombinant antibody (CSB-RA011651MA1HU). The EC50 is 33.73-41.04 ng/mL.
Target Names
Uniprot No.
Alternative Names
Cytokine receptor common subunit gamma; Interleukin 2 receptor subunit gamma; Membrane receptor Il2rg
Species
Macaca mulatta (Rhesus macaque)
Source
Mammalian cell
Expression Region
23-255aa
Target Protein Sequence
LNTTILTPNGNEDATTDFFLTSMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQEKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLRKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNSSKENP
Mol. Weight
28.8 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The common gamma chain (γc) is shared by receptors for IL-2, IL-4, IL-7, IL-9, IL-15, and IL-21, making it a central node in cytokine signaling networks that govern T cell development, NK cell function, and immune homeostasis. This recombinant rhesus macaque IL2RG, spanning the extracellular domain (aa 23–255) and expressed in mammalian cells to preserve native glycosylation and disulfide architecture, demonstrates quantifiable binding to an anti-IL2RG antibody with an EC50 of 33.73–41.04 ng/mL in functional ELISA, confirming conformational integrity suitable for ligand-receptor interaction studies and therapeutic antibody epitope mapping. The protein meets the purity and endotoxin criteria typical for competitive inhibition assays, blocking antibody screening, and SPR-based affinity characterization in cytokine receptor research, with >95% purity by SDS-PAGE and <1.0 EU/μg endotoxin. Researchers investigating primate immunology or translating findings from macaque models can use this reagent as a positive control in binding assays or for validating biologics targeting the γc-dependent cytokine axis.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*