Recombinant Macaca mulatta Cytokine receptor common subunit gamma (IL2RG), partial (Active)

In Stock
Code CSB-MP2765MOW
Abbreviation Recombinant Rhesus macaque IL2RG protein, partial (Active)
MSDS
Size $118
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156 Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Rhesus macaque IL2RG at 2 μg/mL can bind Anti-IL2RG recombinant antibody (CSB-RA011651MA1HU). The EC50 is 33.73-41.04 ng/mL.
Target Names
Uniprot No.
Alternative Names
Cytokine receptor common subunit gamma; Interleukin 2 receptor subunit gamma; Membrane receptor Il2rg
Species
Macaca mulatta (Rhesus macaque)
Source
Mammalian cell
Expression Region
23-255aa
Target Protein Sequence
LNTTILTPNGNEDATTDFFLTSMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQEKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLRKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNSSKENP
Mol. Weight
28.8 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Macaca mulatta IL2RG protein is an active, high-purity product generated in mammalian cells to ensure proper structural integrity and post-translational modifications. It includes the partial of IL2RG, covering amino acids 23 to 255, and features a C-terminal 10xHis tag to support efficient purification and detection. This recombinant IL2RG protein demonstrates greater than 95% purity as confirmed by SDS-PAGE. Its functional performance is validated through ELISA, where immobilized IL2RG at 2 μg/mL specifically binds to the anti-IL2RG recombinant antibody (CSB-RA011651MA1HU), with an EC50 ranging from 33.73 to 41.04 ng/mL. These attributes make it a valuable tool for studying interleukin receptor signaling, antibody screening, and immunological assays involving the common gamma chain.

The IL2RG protein, known as the common gamma chain (γc), is a critical component of several interleukin receptors (IL-2, IL-4, IL-7, IL-9, IL-15, and IL-21) essential for lymphocyte development and function in mammals, including the rhesus macaque (Macaca mulatta). This protein's role is particularly pronounced in the immune system, where it facilitates the signaling processes necessary for the proliferation and differentiation of immune cells, including T and B lymphocytes [1][2].

Research has highlighted the relevance of IL2RG in response to therapeutic interventions and infectious diseases. Mutations in IL2RG lead to severe combined immunodeficiency (SCID) in various species, including macaques, as documented in models used for studying human diseases. This immunodeficiency is attributed to the absence of functional lymphocytes, underscoring the role of IL2RG in T and B cell maturation [2][3]. Rhesus macaques with functional IL2RG are thus used as an essential model to study not only basic immunology but also the efficacy of vaccines and immunotherapies for diseases like HIV [1][2].

Furthermore, a study by Maykel et al. illustrates the involvement of IL2RG in tumor biology and how its expression levels can affect both immune responses and tumor microenvironments in cancers such as breast cancer. This link demonstrates the importance of IL2RG beyond immunological contexts, positioning it as a potential biomarker for understanding tumor interactions with the host immune system [4][5].

Additionally, comprehensive profiling of receptor repertoires in rhesus macaques has shown that variations in IL2RG signaling can shape the functional responses of T and B cells during immune challenges. These insights provide significant data relevant for using macaques in translational research to understand human disease mechanisms, particularly in the context of HIV and cancer [6].

References:
[1] C. Manickam, S. Shah, J. Nohara, G. Ferrari, & R. Reeves. Monkeying around: using non-human primate models to study nk cell biology in hiv infections. Frontiers in Immunology, vol. 10, 2019. https://doi.org/10.3389/fimmu.2019.01124
[2] T. Pearson, L. Shultz, et al. Non-obese diabetic–recombination activating gene-1 (nod–rag 1 null) interleukin (il)-2 receptor common gamma chain (il 2 rγnull) null mice: a radioresistant model for human lymphohaematopoietic engraftment. Clinical & Experimental Immunology, vol. 154, no. 2, p. 270-284, 2008. https://doi.org/10.1111/j.1365-2249.2008.03753.x
[3] G. Finesso, E. Willis, et al. Spontaneous early-onset neurodegeneration in the brainstem and spinal cord of nsg, nog, and nxg mice. Veterinary Pathology, vol. 60, no. 3, p. 374-383, 2023. https://doi.org/10.1177/03009858231151403
[4] J. Maykel, J. Liu, H. Li, L. Shultz, D. Greiner, & J. Houghton. Nod-scidil2rg tm1wjl and nod-rag1 null il2rg tm1wjl : a model for stromal cell–tumor cell interaction for human colon cancer. Digestive Diseases and Sciences, vol. 59, no. 6, p. 1169-1179, 2014. https://doi.org/10.1007/s10620-014-3168-5
[5] X. Liu, G. Jin, et al. Digital gene expression profiling analysis and its application in the identification of genes associated with improved response to neoadjuvant chemotherapy in breast cancer. World Journal of Surgical Oncology, vol. 16, no. 1, 2018. https://doi.org/10.1186/s12957-018-1380-z
[6] L. Fu, X. Li, W. Zhang, et al. A comprehensive profiling of t- and b-lymphocyte receptor repertoires from a chinese-origin rhesus macaque by high-throughput sequencing. Plos One, vol. 12, no. 8, p. e0182733, 2017. https://doi.org/10.1371/journal.pone.0182733

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*