Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Macaca mulatta CD47 at 2 μg/mL can bind Anti-CD47 recombinant antibody (CSB-RA004940MA1HU). The EC50 is 4.473-4.933 ng/mL.

Target Names

CD47

Uniprot No.

F7A802

Alternative Names

/

Species

Macaca mulatta (Rhesus macaque)

Source

Mammalian cell

Expression Region

19-141aa

Target Protein Sequence

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTAPANFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNE

Mol. Weight

15.3 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

CD47 functions as a "don't eat me" signal that enables tumor cells to evade phagocytosis, making it a critical target in cancer immunotherapy research. This recombinant extracellular domain (aa 19–141) expressed in mammalian cells demonstrates specific antibody binding with an EC50 of 4.473–4.933 ng/mL in functional ELISA, providing quantitative evidence of conformational integrity suitable for therapeutic antibody epitope mapping, competitive inhibition screening, and blocking antibody validation studies. The mammalian expression system supports native glycosylation and disulfide bond formation characteristic of the immunoglobulin variable-like domain, which is essential for accurate ligand-receptor interaction assays including surface plasmon resonance and biolayer interferometry. With purity exceeding 95% and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for antibody affinity characterization and serves as a positive control in binding assays evaluating anti-CD47 therapeutics.

Code	CSB-MP6802MOW
Abbreviation	Recombinant Rhesus macaque CD47 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$138
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Macaca mulatta CD47 at 2 μg/ml can bind Anti-CD47 recombinant antibody (CSB-RA004940MA1HU). The EC₅₀ is 4.473-4.933 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Macaca mulatta Leukocyte surface antigen CD47 (CD47), partial (Active)

Product Details

Customer Reviews and Q&A

×CloseMessage