Recombinant Macaca mulatta Leukocyte surface antigen CD47 (CD47), partial (Active)

In Stock
Code CSB-MP6802MOW
Abbreviation Recombinant Rhesus macaque CD47 protein, partial (Active)
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Macaca mulatta CD47 at 2 μg/ml can bind Anti-CD47 recombinant antibody (CSB-RA004940MA1HU). The EC50 is 4.473-4.933 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca mulatta CD47 at 2 μg/mL can bind Anti-CD47 recombinant antibody (CSB-RA004940MA1HU). The EC50 is 4.473-4.933 ng/mL.
Target Names
Uniprot No.
Alternative Names
/
Species
Macaca mulatta (Rhesus macaque)
Source
Mammalian cell
Expression Region
19-141aa
Target Protein Sequence
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTAPANFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNE
Mol. Weight
15.3 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

CD47 functions as a "don't eat me" signal that enables tumor cells to evade phagocytosis, making it a critical target in cancer immunotherapy research. This recombinant extracellular domain (aa 19–141) expressed in mammalian cells demonstrates specific antibody binding with an EC50 of 4.473–4.933 ng/mL in functional ELISA, providing quantitative evidence of conformational integrity suitable for therapeutic antibody epitope mapping, competitive inhibition screening, and blocking antibody validation studies. The mammalian expression system supports native glycosylation and disulfide bond formation characteristic of the immunoglobulin variable-like domain, which is essential for accurate ligand-receptor interaction assays including surface plasmon resonance and biolayer interferometry. With purity exceeding 95% and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for antibody affinity characterization and serves as a positive control in binding assays evaluating anti-CD47 therapeutics.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*