Product Details

Purity

≥ 95% as determined by SDS-PAGE.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Mouse Tnfsf15 at 2 μg/mL can bind Anti-TNFSF15 recombinant antibody (CSB-RA023992MA1HU). The EC50 is 1.671-2.506 ng/mL.

Target Names

Tnfsf15

Uniprot No.

Q5UBV8

Alternative Names

TNF ligand-related molecule 1; Vascular endothelial cell growth inhibitorGene names

Species

Mus musculus (Mouse)

Source

Mammalian cell

Expression Region

61-252aa

Target Protein Sequence

AGQLRVPGKDCMLRAITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL

Mol. Weight

24.3 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Tumor necrosis factor superfamily member 15 functions as a vascular endothelial growth inhibitor and immune modulator, making it a critical target in cancer biology and inflammatory disease research. This partial construct spanning residues 61–252 demonstrates robust receptor-binding activity with an EC50 of 1.671–2.506 ng/mL in functional ELISA against a recombinant anti-TNFSF15 antibody, providing quantitative evidence that the protein retains native epitope presentation suitable for antibody development, validation studies, and as a coating antigen in immunoassays. Mammalian cell expression yields an N-terminal 10×His-tagged protein that meets the quality thresholds commonly required for cell-based functional assays, including endothelial cell proliferation, apoptosis studies, and NF-κB or MAPK signaling pathway investigations where endotoxin interference must be minimized. With endotoxin levels below 1.0 EU/μg and purity exceeding 95% by SDS-PAGE, this preparation supports use in immune cell activation experiments and in vivo tumor models where low endotoxin is essential to isolate TNFSF15-specific biological effects from LPS-driven artifacts.

Target Background

Function

Receptor for TNFRSF25 and TNFRSF6B. Mediates activation of NF-kappa-B. Inhibits vascular endothelial growth and angiogenesis (in vitro). Promotes activation of caspases and apoptosis. Promotes splenocyte alloactivation.

Gene References into Functions

TL1A blocking ameliorates intestinal fibrosis in the T cell transfer model of chronic colitis PMID: 29254800
ATF3 protects against LPS-induced acute lung injury by inhibiting TL1A expression. PMID: 28177121
this study shows that TL1A-/- mice are more susceptible to dextran sodium sulfate colitis PMID: 27233964
These data demonstrated a direct role for TL1A-DR3 signaling in tissue fibrosis and that modulation of TL1A-DR3 signaling could inhibit gut fibrosis. PMID: 24850426
TL1A deficiency impacts on the gut microbial composition and the mucosal immune system, especially the intraepithelial TCRgammadelta(+) T-cell subset, and that TL1A is involved in the establishment of adipose tissue. PMID: 25404161
Our data demonstrate a key role for TL1A in promoting ILC2s at mucosal barriers. PMID: 24220298
delivers survival signals to plasma cells and promotes pathogenic Ab production in collagen arthritis PMID: 24140642
TNFSF15 inhibits vasculogenesis by regulating relative levels of membrane-bound and soluble isoforms of VEGF receptor 1. PMID: 23918400
These results establish a novel link between tumor necrosis factor (TNF)-family cytokine TL1A (TNFSF15) and interleukin 13 (IL-13) responses that results in small intestinal inflammation. PMID: 20980995
role of TL1A in mucosal T cells and antigen presenting cells function and showed that up-regulation of TL1A expression can promote mucosal inflammation and gut fibrosis. PMID: 21264313
findings suggest that the transcription factor NF-kappaB plays an important role in the regulation of VEGI expression PMID: 15702971
neonatal CD4+ CD3- cells up-regulate both CD30L and OX40L after adoptive transfer into an adult recipient PMID: 16920944
VEGI may have a key role in both the termination of angiogenesis and facilitation of dendritic cell maturation, which is the initial step in immune responses toward inflammatory stimuli. PMID: 17785811
TL1A may contribute to renal inflammation and injury through DR3-mediated activation of NF-kappaB and caspase-3 PMID: 18287561
Results reveal that TL1A is an important modulator in the development of chronic mucosal inflammation by enhancing T(H)1 and T(H)17 effector functions. PMID: 18598698

Hide All

Subcellular Location

Membrane; Single-pass type II membrane protein.

Protein Families

Tumor necrosis factor family

Database Links

KEGG: mmu:326623

STRING: 10090.ENSMUSP00000050144

UniGene: Mm.208152

Code	CSB-MP729268MO
Abbreviation	Recombinant Mouse Tnfsf15 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$136
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Mouse Tnfsf15 at 2 μg/ml can bind Anti-TNFSF15 recombinant antibody (CSB-RA023992MA1HU). The EC₅₀ is 1.671-2.506 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Tumor necrosis factor ligand superfamily member 15 (Tnfsf15), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage