Recombinant Rat Gastric inhibitory polypeptide receptor (Gipr), partial (Active)

In Stock
Code CSB-MP009438RA1
MSDS
Size $396
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Rat Gipr at 2μg/mL can bind Anti-Mouse Gipr recombinant antibody (CSB-RA009438MA1MO), the EC50 is 6.946-8.740 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Rat Gipr at 2 μg/mL can bind Anti-Mouse Gipr recombinant antibody (CSB-RA009438MA1MO), the EC50 is 6.946-8.740 ng/ml.
Target Names
Gipr
Uniprot No.
Alternative Names
Gastric inhibitory polypeptide receptor;GIP-R;Glucose-dependent insulinotropic polypeptide receptor;Gipr
Species
Rattus norvegicus (Rat)
Source
Mammalian cell
Expression Region
19-135aa
Target Protein Sequence
RAETDSEGQTTGELYQRWERYGWECQNTLEATEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWYRQVAAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQKLILERLQ
Mol. Weight
14.9 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Using the mammalian cell expression system, CUSABIO has generated the recombinant rat gastric inhibitory polypeptide receptor (Gipr). The gene sequence corresponding to amino acids 19 to 135 of the rat Gipr protein is fused with a 10xHis-tag gene at the C-terminus. This combined gene sequence is then integrated into a plasmid vector and introduced into mammalian cells via transfection. Following transfection, the mammalian cells are cultivated to facilitate the expression of the protein. The resulting recombinant rat Gipr protein is harvested from the lysate of these cells. Its purity, determined by SDS-PAGE, exceeds 95%. The protein boasts low endotoxin levels, measuring below 1.0 EU/μg through the LAL method. Its functionality is validated through a functional ELISA. When immobilized at a concentration of 2 μg/mL, the Gipr protein effectively binds with the Anti-mouse Gipr recombinant antibody (CSB-RA009438MA1MO), exhibiting an EC50 within the range of 6.946 to 8.740 ng/ml.

Gipr belongs to the class B1 G-protein-coupled receptor kinase and plays a crucial role in various aspects such as human adipose transformation, the proliferation of pancreatic β-cells, and insulin release, being associated with type 2 diabetes and obesity. Activation of the GIP-Gipr signaling pathway not only stimulates the secretion of insulin and glucagon-like peptide-1 but also promotes the proliferation and survival of pancreatic β-cells, playing a significant role in blood glucose regulation. Research has found a close correlation between the Gipr gene polymorphism and the occurrence of obesity. With the increasing demand in the obesity drug market, more drugs for obesity treatment are being developed. Mouse Gipr shares about 83% homology with human Gipr, and their structure and function are relatively similar. Therefore, preparing active mouse Gipr protein is beneficial for developing drugs with cross-species reactivity and advancing clinical drug research and development.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This is a receptor for GIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Gene References into Functions
  1. glucose-dependent insulinotropic polypeptide and Glucose-dependent insulinotropic polypeptide receptors expression in the rat major salivary glands, as well as its variation in the rat SMG during the growth period PMID: 24360021
  2. Disruption of a signaling pathway may account for the lowered beta-cell GIP-R expression and resulting GIP resistance in type 2 diabetes. PMID: 20332343
  3. A novel pathway for downregulation of GIP receptor expression in Pancreatic beta Cells. PMID: 12475913
  4. The GIP receptor is expressed by cultured adult hippocampal progenitors and throughout the granule cell layer of the dentate gyrus, including progenitor cells. Thus, these cells have the ability to respond to GIP. PMID: 15716418
  5. Reduction of GLP-1 receptor expression by high glucose was prevented by dominant-negative protein kinase C (PKC)alpha. PMID: 17360984
  6. GIP-R is ubiquitinated, resulting in downregulation of the actions of GIP. PMID: 17505054
  7. These findings support the proposal that GIP receptor down-regulation in rodent T2DM is secondary to chronic hyperglycemia and that normalization of glycemia can restore GIP sensitivity. PMID: 17803965

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 2 family
Tissue Specificity
Present in the pancreas as well as the gut, adipose tissue, heart, pituitary, and inner layers of the adrenal cortex, whereas it is not found in kidney, spleen, or liver. It is also expressed in several brain regions, including the cerebral cortex, hippoc
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*