Product Details

Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Rat Gipr at 2μg/mL can bind Anti-Mouse Gipr recombinant antibody (CSB-RA009438MA1MO)， the EC50 is 26.97 - 33.90 ng/mL.

Target Names

Gipr

Uniprot No.

P43219

Alternative Names

Gastric inhibitory polypeptide receptor;GIP-R;Glucose-dependent insulinotropic polypeptide receptor;Gipr

Species

Rattus norvegicus (Rat)

Source

Mammalian cell

Expression Region

19-135aa

Target Protein Sequence

RAETDSEGQTTGELYQRWERYGWECQNTLEATEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWYRQVAAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQKLILERLQ

Mol. Weight

14.9 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

GIPR mediates the insulinotropic effects of glucose-dependent insulinotropic polypeptide and represents a key target in metabolic disease research, yet studying its extracellular domain in isolation requires a system that preserves native glycosylation and disulfide architecture. This mammalian-expressed fragment spanning residues 19–135 captures the ligand-binding domain and demonstrates quantifiable binding activity in functional ELISA, achieving an EC50 of 26.97–33.90 ng/mL when immobilized at 2 μg/mL against a recombinant anti-GIPR antibody. The validated binding kinetics support its use in competitive inhibition assays, therapeutic antibody epitope mapping, and screening campaigns for biologics or small molecules targeting the GIP signaling axis. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for SPR-based affinity characterization, biolayer interferometry, and antibody validation workflows in obesity and diabetes research.

Target Background

Function

This is a receptor for GIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

Gene References into Functions

glucose-dependent insulinotropic polypeptide and Glucose-dependent insulinotropic polypeptide receptors expression in the rat major salivary glands, as well as its variation in the rat SMG during the growth period PMID: 24360021
Disruption of a signaling pathway may account for the lowered beta-cell GIP-R expression and resulting GIP resistance in type 2 diabetes. PMID: 20332343
A novel pathway for downregulation of GIP receptor expression in Pancreatic beta Cells. PMID: 12475913
The GIP receptor is expressed by cultured adult hippocampal progenitors and throughout the granule cell layer of the dentate gyrus, including progenitor cells. Thus, these cells have the ability to respond to GIP. PMID: 15716418
Reduction of GLP-1 receptor expression by high glucose was prevented by dominant-negative protein kinase C (PKC)alpha. PMID: 17360984
GIP-R is ubiquitinated, resulting in downregulation of the actions of GIP. PMID: 17505054
These findings support the proposal that GIP receptor down-regulation in rodent T2DM is secondary to chronic hyperglycemia and that normalization of glycemia can restore GIP sensitivity. PMID: 17803965

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 2 family

Tissue Specificity

Present in the pancreas as well as the gut, adipose tissue, heart, pituitary, and inner layers of the adrenal cortex, whereas it is not found in kidney, spleen, or liver. It is also expressed in several brain regions, including the cerebral cortex, hippoc

Database Links

KEGG: rno:25024

STRING: 10116.ENSRNOP00000021456

UniGene: Rn.9676

Code	CSB-MP009438RA1
Abbreviation	Recombinant Rat Gipr protein, partial (Active)
MSDS	MSDS Datasheet
Size	$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Rat Gipr at 2μg/mL can bind Anti-Mouse Gipr recombinant antibody (CSB-RA009438MA1MO)， the EC₅₀ is 26.97 - 33.90 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Rat Gastric inhibitory polypeptide receptor (Gipr), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage