Recombinant Rat Gastric inhibitory polypeptide receptor (Gipr), partial (Active)

In Stock
Code CSB-MP009438RA1
Abbreviation Recombinant Rat Gipr protein, partial (Active)
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Rat Gipr at 2μg/mL can bind Anti-Mouse Gipr recombinant antibody (CSB-RA009438MA1MO), the EC50 is 26.97 - 33.90 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Rat Gipr at 2μg/mL can bind Anti-Mouse Gipr recombinant antibody (CSB-RA009438MA1MO), the EC50 is 26.97 - 33.90 ng/mL.
Target Names
Uniprot No.
Alternative Names
Gastric inhibitory polypeptide receptor;GIP-R;Glucose-dependent insulinotropic polypeptide receptor;Gipr
Species
Rattus norvegicus (Rat)
Source
Mammalian cell
Expression Region
19-135aa
Target Protein Sequence
RAETDSEGQTTGELYQRWERYGWECQNTLEATEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWYRQVAAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQKLILERLQ
Mol. Weight
14.9 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant rat Gipr protein, encompassing the extracellular domain (amino acids 19-135), is expressed in mammalian cells with a C-terminal 10×His tag, ensuring proper folding and post-translational modifications critical for receptor- ligand interactions. The recombinant Gipr protein exhibits exceptional purity (>95% by SDS-PAGE) and low endotoxin levels (<1.0 EU/μg, LAL method), meeting rigorous quality standards for functional assays. Validated via ELISA, it demonstrates specific binding to anti-mouse Gipr antibody (CSB-RA009438MA1MO) (EC50: 6.946–8.740 ng/mL at 2 μg/mL immobilization), confirming cross-species reactivity and structural integrity. The mammalian expression system preserves native conformational epitopes, which is essential for studying Gipr's role in glucose metabolism and insulin regulation. Provided as lyophilized powder, this preparation ensures stability and ease of reconstitution. It is ideal for investigating GIP-mediated signaling pathways, drug discovery for metabolic disorders, and receptor activation studies in diabetes research.

The Gipr is a critical G-protein coupled receptor (GPCR) that plays a significant role in the physiological response to glucose intake. Specifically, the Gipr mediates the effects of gastric inhibitory polypeptide (GIP), a hormone secreted by the K-cells of the intestine, which primarily stimulates insulin secretion from pancreatic β-cells in a glucose-dependent manner. This process is crucial in the regulation of blood glucose levels and overall glucose metabolism [1][2].

The Gipr gene in rats, as in many species, consists of multiple exons, with evidence suggesting that in rats, it is composed of 15 exons, leading to diverse receptor forms through alternative splicing [2]. Notably, the rat Gipr demonstrates a high degree of sequence homology to its human counterpart (approximately 80%), indicating conserved functional properties across species [3]. This high level of conservation allows researchers to study the Gipr function in rats as a proxy for human biology, especially in the context of metabolic diseases such as obesity and type 2 diabetes [4].

Recent studies have shown that Gipr expression is not restricted to the pancreas but is also prevalent in various regions of the central nervous system, including the hypothalamus, olfactory bulb, and hippocampus [5][6][7]. The expression of Gipr in the brain suggests that it may have roles beyond glucose metabolism, potentially influencing neuroendocrine activity, appetite regulation, and food intake. For instance, activation of hypothalamic Gipr-expressing neurons is linked to reduced food intake and regulation of energy balance [8]. This highlights the importance of Gipr in both metabolic and neurological contexts, emphasizing its potential as a therapeutic target in diseases like obesity and diabetes.

In terms of functional dynamics, Gipr is known to undergo variations in expression under different physiological and pathological conditions. For example, in models of type 2 diabetes, such as the Zucker diabetic fatty rat, Gipr mRNA and protein levels are significantly reduced in pancreatic islets, contributing to insulin secretion dysfunction [6][9]. Similarly, other models have indicated that alterations in Gipr expression can affect the insulinotropic action of GIP, leading to compromised glucose tolerance [10]. Moreover, receptor desensitization and downregulation in response to chronic stimulation can mimic functional antagonism, complicating therapeutic strategies aimed at enhancing Gipr functionality [4][11].

References:
[1] S. Sherman, J. Carr, D. Wang, M. O’Dorisio, T. O’Dorisio, & J. Howe. Gastric inhibitory polypeptide receptor (gipr) is a promising target for imaging and therapy in neuroendocrine tumors. Surgery, vol. 154, no. 6, p. 1206-1214, 2013. https://doi.org/10.1016/j.surg.2013.04.052
[2] C. Gaudin-Audrain, N. Irwin, et al. Glucose-dependent insulinotropic polypeptide receptor deficiency leads to modifications of trabecular bone volume and quality in mice. Bone, vol. 53, no. 1, p. 221-230, 2013. https://doi.org/10.1016/j.bone.2012.11.039
[3] C. Kelley, S. Decker, P. Silva, & J. Forrest. Gastric inhibitory peptide, serotonin, and glucagon are unexpected chloride secretagogues in the rectal gland of the skate (leucoraja erinacea). Ajp Regulatory Integrative and Comparative Physiology, vol. 306, no. 9, p. R674-R680, 2014. https://doi.org/10.1152/ajpregu.00531.2013
[4] E. Killion, M. Chen, et al. Chronic glucose-dependent insulinotropic polypeptide receptor (gipr) agonism desensitizes adipocyte gipr activity mimicking functional gipr antagonism. Nature Communications, vol. 11, no. 1, 2020. https://doi.org/10.1038/s41467-020-18751-8
[5] P. Higgins, R. Shade, et al. Central gip signaling stimulates peripheral gip release and promotes insulin and pancreatic polypeptide secretion in nonhuman primates. Ajp Endocrinology and Metabolism, vol. 311, no. 4, p. E661-E670, 2016. https://doi.org/10.1152/ajpendo.00166.2016
[6] F. Lynn, N. Pamir, E. Ng, C. McIntosh, T. Kieffer, & R. Pederson. Defective glucose-dependent insulinotropic polypeptide receptor expression in diabetic fatty zucker rats. Diabetes, vol. 50, no. 5, p. 1004-1011, 2001. https://doi.org/10.2337/diabetes.50.5.1004
[7] A. Adriaenssens, E. Biggs, et al. Glucose-dependent insulinotropic polypeptide receptor-expressing cells in the hypothalamus regulate food intake., Cell Metabolism, vol. 30, no. 5, p. 987-996.e6, 2019. https://doi.org/10.1016/j.cmet.2019.07.013
[8] C. Smith, R. Patterson-Cross, et al. A comparative transcriptomic analysis of glucagon-like peptide-1 receptor- and glucose-dependent insulinotropic polypeptide receptor-expressing cells in the hypothalamus. Appetite, vol. 174, p. 106022, 2022. https://doi.org/10.1016/j.appet.2022.106022
[9] J. Nyberg, M. Anderson, et al. Glucose-dependent insulinotropic polypeptide is expressed in adult hippocampus and induces progenitor cell proliferation. Journal of Neuroscience, vol. 25, no. 7, p. 1816-1825, 2005. https://doi.org/10.1523/jneurosci.4920-04.2005
[10] M. Gabe, W. Velden, et al. Enhanced agonist residence time, internalization rate and signalling of the gip receptor variant [e354q] facilitate receptor desensitization and long‐term impairment of the gip system. Basic & Clinical Pharmacology & Toxicology, vol. 126, no. S6, p. 122-132, 2019. https://doi.org/10.1111/bcpt.13289
[11] D. Gupta, M. Peshavaria, N. Monga, T. Jetton, & J. Leahy. Physiologic and pharmacologic modulation of glucose-dependent insulinotropic polypeptide (gip) receptor expression in β-cells by peroxisome proliferator–activated receptor (ppar)-γ signaling. Diabetes, vol. 59, no. 6, p. 1445-1450, 2010. https://doi.org/10.2337/db09-1655

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This is a receptor for GIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Gene References into Functions
  1. glucose-dependent insulinotropic polypeptide and Glucose-dependent insulinotropic polypeptide receptors expression in the rat major salivary glands, as well as its variation in the rat SMG during the growth period PMID: 24360021
  2. Disruption of a signaling pathway may account for the lowered beta-cell GIP-R expression and resulting GIP resistance in type 2 diabetes. PMID: 20332343
  3. A novel pathway for downregulation of GIP receptor expression in Pancreatic beta Cells. PMID: 12475913
  4. The GIP receptor is expressed by cultured adult hippocampal progenitors and throughout the granule cell layer of the dentate gyrus, including progenitor cells. Thus, these cells have the ability to respond to GIP. PMID: 15716418
  5. Reduction of GLP-1 receptor expression by high glucose was prevented by dominant-negative protein kinase C (PKC)alpha. PMID: 17360984
  6. GIP-R is ubiquitinated, resulting in downregulation of the actions of GIP. PMID: 17505054
  7. These findings support the proposal that GIP receptor down-regulation in rodent T2DM is secondary to chronic hyperglycemia and that normalization of glycemia can restore GIP sensitivity. PMID: 17803965

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 2 family
Tissue Specificity
Present in the pancreas as well as the gut, adipose tissue, heart, pituitary, and inner layers of the adrenal cortex, whereas it is not found in kidney, spleen, or liver. It is also expressed in several brain regions, including the cerebral cortex, hippoc
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*