Home
Active Protein
Other
Recombinant Rat Intestinal-type alkaline phosphatase 1 (Alpi) (Active)

Recombinant Rat Intestinal-type alkaline phosphatase 1 (Alpi) (Active)

^{In Stock}

Code	CSB-MP001627RA
Abbreviation	Recombinant Rat Alpi protein (Active)
MSDS	MSDS Datasheet
Size	$116
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Unit Definition:One unit is defined as the amount of enzyme required to cleave 1 nmol p-nitro-phenylphosphate(pNPP), in 1 minute at 37°C, pH10.0.The specific activity is >10370.37 U/mg.

Target Names

Alpi

Uniprot No.

P15693

Alternative Names

(IAP-1)(Intestinal alkaline phosphatase 1)(Intestinal alkaline phosphatase I)(IAP-I)

Molecular Characterization

Species

Rattus norvegicus (Rat)

Source

Mammalian cell

Expression Region

21-511aa

Target Protein Sequence

VIPVEEENPVFWNQKAKEALDVAKKLQPIQTSAKNLILFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRDWYSDADMPSSALQEGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPGDSDQSGVRLDSRNLVEEWLAKYQGTRYVWNREQLMQASQDPAVTRLMGLFEPTEMKYDVNRNASADPSLAEMTEVAVRLLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLTLITADHSHVFAFGGYTLRGTSIFGLAPLNAQDGKSYTSILYGNGPGYVLNSGNRPNVTDAESGDVNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPADENRPTTPVQN

Mol. Weight

55.9 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

To creat active recombinant rat intestinal-type alkaline phosphatase (Alpi) in mammalian cells, the gene region encoding amino acids 21-511 of the rat Alpi protein is inserted into an expression vector containing an N-terminal 10xHis-tag. The recombinant vector is then transfected into mammalian cells using transfection techniques. The transfected cells are cultured to allow the expression of the recombinant Alpi protein. After expression, the cells are collected, and the recombinant protein is purified from the cell lysate. The purified recombinant Alpi protein demonstrates a purity exceeding 95% based on SDS-PAGE analysis. The specific activity of the recombinant Alpi protein is measured to be greater than 10370.37 U/mg, confirming its enzymatic function. Additionally, the endotoxin level of the recombinant Alpi protein is determined to be less than 1.0 EU/μg using the LAL method.

Customer Reviews and Q&A

■ Customer Reviews

Average Rating:

5.0 - 1 reviews

Submit a Review here

Applications : Binding assay/Protein-protein interaction

Review: I used the CSB-MP001627RA product to develop a competitive ELISA method, and the results showed that the protein had good binding activity, stable properties, and excellent repeatability, and all parameter indicators met the standards. It is a repeat purchase, and I will continue to purchase this product.

By Anonymous