Recombinant Bovine Polymeric immunoglobulin receptor(PIGR),partial

Code CSB-EP017981BO
Product Type Recombinant Protein
Size US$2466
Uniprot No. P81265
Relevance This receptor binds polymeric IgA and IgM at the basolateral surface of epithelial cells. The complex is then transported across the cell to be secreted at the apical surface. During this process a cleavage occurs that separates the Extracellular domain (known as the secretory component) from the transmbrane segment.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Bos taurus (Bovine)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SRGLIKEQYEGRLALLTEPGNGTYTVILNQLTDQDTGFYWCVTDGDTRWISTVELKVVQGEPSLKVPKNVTAWLGEPLKLSCHFPCKFYSFEKYWCKWSNRGCSALPTQNDGPSQAFVSCDQNSQVVSLNLDTVTKEDEGWYWCGVKEGPRYGETAAVYVAVESRVKGSQGAKQVKAAPAGAAIQSRAGEIQNKALLDPS
Research Area Others
Source E.coli
Gene Names PIGR
Expression Region 400-599aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 26.0kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This receptor binds polymeric IgA and IgM at the basolateral surface of epithelial cells. The complex is then transported across the cell to be secreted at the apical surface. During this process a cleavage occurs that separates the extracellular (known as the secretory component) from the transmembrane segment.
Subcellular Location Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Secretory component: Secreted
Tissue Specificity Found in mammary gland, jejunum, lung, kidney and small intestine.
Database Links

KEGG: bta:281401

STRING: 9913.ENSBTAP00000026377

UniGene: Bt.4695

Related Products

PIGR Antibodies

PIGR Antibodies for Bovine

PIGR Proteins

PIGR Proteins for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.