Recombinant Cricetulus griseus Peroxiredoxin-1 (PRDX1)

In Stock
Code CSB-EP872876DXU
Abbreviation Recombinant Cricetulus griseus P4HB protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP872876DXU could indicate that this peptide derived from E.coli-expressed Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus) PRDX1.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP872876DXU could indicate that this peptide derived from E.coli-expressed Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus) PRDX1.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
PRDX1; TDPX2Peroxiredoxin-1; EC 1.11.1.15; Thioredoxin peroxidase 2; TPX-2
Species
Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
Source
E.coli
Expression Region
2-199aa
Target Protein Sequence
SSGNAKIGYPAPNFKATAVMPDGQFRDICLSEYRGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.1kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

A DNA corresponding to 2-199aa of Cricetulus griseus Peroxiredoxin-1 (PRDX1) was fused with an N-terminal 6xHis-tag and then expressed in E.coli. The resulting protein is a Recombinant Full-length pf Mature Cricetulus griseus PRDX1. This PRDX1 protein underwent the validation of SDS-PAGE and LC-MS/MS Analyses. The purity of the protein is over 90%. Its predicted molecular weight is 26.1 kDa. In addition to being an immunogen for antibody synthesis, this recombinant PRDX1 may also find uses in the studies of PRDX1-involved cell biology. In-stock PRDX1 proteins are available.

PRDX1 belongs to the superfamily of small non-seleno peroxidases and exerts a peroxide-scavenging function. In addition, PRDX1 also orchestrates redox-regulated signaling in a ROS dose-dependent manner through the oxidation status of its peroxidative cysteine Cys52. The peroxidative cysteine Cys52 of PRDX1 acts as a sensor in ROS signaling. PRDX1 promotes both MKP-1 and MKP-5 activity under normal ROS homeostasis. Upon ROS increasing, PRDX1 becomes over-oxidized and less available to bind to MKP-1, eliciting MKP-1 oxidation-induced oligomerization and inactivity toward p38MAPKα, thus facilitating apoptosis.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation.
Subcellular Location
Cytoplasm.
Protein Families
Peroxiredoxin family, AhpC/Prx1 subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*