Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

CSF3

Uniprot No.

P35834

Research Area

Stem Cells

Alternative Names

CSF3; Granulocyte colony-stimulating factor; G-CSF

Species

Canis lupus familiaris (Dog) (Canis familiaris)

Source

E.coli

Expression Region

1-175aa

Target Protein Sequence

MAPLGPTGPLPQSFLLKCLEQMRKVQADGTALQETLCATHQLCHPEELVLLGHALGIPQPPLSSCSSQALQLMGCLRQLHSGLFLYQGLLQALAGISPELAPTLDTLQLDTTDFAINIWQQMEDLGMAPAVPPTQGTMPAFTSAFQRRAGGVLVASNLQSFLELAYRALRHFAKP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

34.9kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Dog CSF3 was expressed with the amino acid range of 1-175. The calculated molecular weight for this CSF3 protein is 34.9 kDa. The CSF3 protein was expressed in e.coli. The CSF3 gene fragment has been modified by fusing the N-terminal 6xHis-SUMO tag, providing convenience in detecting and purifying the recombinant CSF3 protein during the following stages.

The dog granulocyte colony-stimulating factor (CSF3) is a cytokine that plays a crucial role in regulating the production and function of neutrophils, a type of white blood cell involved in the immune response. CSF3 stimulates the proliferation, differentiation, and maturation of neutrophil precursor cells in the bone marrow, enhancing the release of mature neutrophils into the bloodstream. This cytokine is essential for maintaining an effective immune response against bacterial and fungal infections. Research on dog CSF3 contributes to understanding immune system dynamics in canines, providing insights into hematopoiesis, immune function, and potential applications in veterinary medicine for managing conditions associated with neutropenia.

Target Background

Function

Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes.

Subcellular Location

Secreted.

Protein Families

IL-6 superfamily

Database Links

STRING: 9615.ENSCAFP00000023945

Code	CSB-EP006049DO
Abbreviation	Recombinant Dog CSF3 protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Dog Granulocyte colony-stimulating factor (CSF3)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage