Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
CSF3; Granulocyte colony-stimulating factor; G-CSF
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Expression Region
1-175aa
Target Protein Sequence
MAPLGPTGPLPQSFLLKCLEQMRKVQADGTALQETLCATHQLCHPEELVLLGHALGIPQPPLSSCSSQALQLMGCLRQLHSGLFLYQGLLQALAGISPELAPTLDTLQLDTTDFAINIWQQMEDLGMAPAVPPTQGTMPAFTSAFQRRAGGVLVASNLQSFLELAYRALRHFAKP
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Dog CSF3 was expressed with the amino acid range of 1-175. The calculated molecular weight for this CSF3 protein is 34.9 kDa. The CSF3 protein was expressed in e.coli. The CSF3 gene fragment has been modified by fusing the N-terminal 6xHis-SUMO tag, providing convenience in detecting and purifying the recombinant CSF3 protein during the following stages.
The dog granulocyte colony-stimulating factor (CSF3) is a cytokine that plays a crucial role in regulating the production and function of neutrophils, a type of white blood cell involved in the immune response. CSF3 stimulates the proliferation, differentiation, and maturation of neutrophil precursor cells in the bone marrow, enhancing the release of mature neutrophils into the bloodstream. This cytokine is essential for maintaining an effective immune response against bacterial and fungal infections. Research on dog CSF3 contributes to understanding immune system dynamics in canines, providing insights into hematopoiesis, immune function, and potential applications in veterinary medicine for managing conditions associated with neutropenia.
