Recombinant Enterobacteria phage T4 Fibritin (wac)

In Stock
Code CSB-EP319157EDZ
Abbreviation Recombinant Enterobacteria phage T4 Fibritin protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP319157EDZ could indicate that this peptide derived from E.coli-expressed Enterobacteria phage T4 (Bacteriophage T4) wac.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP319157EDZ could indicate that this peptide derived from E.coli-expressed Enterobacteria phage T4 (Bacteriophage T4) wac.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
wacFibritin; Collar protein; Whisker antigen control protein
Species
Enterobacteria phage T4 (Bacteriophage T4)
Source
E.coli
Expression Region
2-487aa
Target Protein Sequence
TDIVLNDLPFVDGPPAEGQSRISWIKNGEEILGADTQYGSEGSMNRPTVSVLRNVEVLDKNIGILKTSLETANSDIKTIQGILDVSGDIEALAQIGINKKDISDLKTLTSEHTEILNGTNNTVDSILADIGPFNAEANSVYRTIRNDLLWIKRELGQYTGQDINGLPVVGNPSSGMKHRIINNTDVITSQGIRLSELETKFIESDVGSLTIEVGNLREELGPKPPSFSQNVYSRLNEIDTKQTTVESDISAIKTSIGYPGNNSIITSVNTNTDNIASINLELNQSGGIKQRLTVIETSIGSDDIPSSIKGQIKDNTTSIESLNGIVGENTSSGLRANVSWLNQIVGTDSSGGQPSPPGSLLNRVSTIETSVSGLNNAVQNLQVEIGNNSAGIKGQVVALNTLVNGTNPNGSTVEERGLTNSIKANETNIASVTQEVNTAKGNISSLQGDVQALQEAGYIPEAPRDGQAYVRKDGEWVFLSTFLSPA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
67.7kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Enterobacteria phage T4 Fibritin (wac) is produced in E.coli and contains the full-length mature protein, spanning amino acids 2-487. The protein includes an N-terminal 6xHis-SUMO tag that helps with purification and detection. SDS-PAGE analysis confirms the product reaches greater than 90% purity, which appears to make it suitable for various research applications.

Fibritin is a structural protein from Enterobacteria phage T4 that plays a critical role in phage assembly. This protein is involved in forming the phage tail—a component that seems crucial for both infectivity and viral stability. The unique characteristics of fibritin likely make it an important target for studies examining viral assembly mechanisms and protein-protein interactions in phage biology.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The T4 phage Fibritin is a structural protein that naturally forms trimers and functions as a molecular "glue" in phage tail assembly. While the SUMO tag may enhance solubility in E. coli, fibritin requires precise trimerization and proper folding for its native bioactivity (facilitating phage tail fiber attachment). E. coli can express viral proteins but may not replicate the exact oligomerization state without a proper cellular context. The large SUMO tag (≈100 aa) may sterically interfere with trimer formation. Without experimental validation of oligomerization and function, the protein cannot be assumed to be correctly folded or bioactive.

1. Protein-Protein Interaction Studies Using Pull-Down Assays

The His-SUMO tag enables pull-down assays to identify binding partners (e.g., other phage proteins). However, if fibritin is misfolded or fails to trimerize, interactions may be non-physiological. Validate any identified partners using native fibritin from phage particles or confirm trimerization (e.g., via size-exclusion chromatography) before interaction studies.

2. Antibody Development and Immunological Studies

This application is suitable. The recombinant fibritin can serve as an immunogen for antibody production, as antibodies often recognize linear epitopes even in misfolded proteins. The high purity supports consistent immunization. However, antibodies generated may not recognize conformational epitopes specific to the native trimeric form. Validate antibody specificity against native T4 phage particles.

3. Biochemical Characterization and Stability Studies

This T4 phage Fibritin is suitable for basic biophysical analysis (e.g., circular dichroism for secondary structure, dynamic light scattering for aggregation state). However, data may not reflect native trimeric fibritin properties due to potential misfolding or tag interference. Use analytical ultracentrifugation or native PAGE to check trimer formation before structural conclusions.

4. ELISA-Based Binding Assays

Feasible only if the protein is properly folded and trimerized. Misfolded fibritin may not bind physiological partners (e.g., tail fibers) accurately, leading to false negatives. Confirm native structure and oligomerization before quantitative binding studies. The SUMO tag may sterically hinder binding sites.

Final Recommendation & Action Plan

Before using this recombinant fibritin for functional studies, validate its oligomerization and folding. First, analyze the oligomeric state via size-exclusion chromatography with multi-angle light scattering (SEC-MALS) or native PAGE to confirm trimer formation. If trimeric, test functionality in vitro (e.g., binding to T4 tail fibers). If inactive or monomeric, limit use to non-functional applications like antibody production (with validation against phage particles). For reliable interaction studies, consider expressing fibritin in a system that supports proper trimerization, or remove the SUMO tag to minimize steric interference. Always include appropriate controls (e.g., wild-type fibritin from phage) when studying binding or function.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Chaperone involved in tail fiber assembly and retraction. Acts as a chaperone helping to attach the long tail fibers to the virus during the assembly process. During phage assembly, twelve fibritin molecules attach to the phage neck via gp13: six molecules forming the collar and six molecules forming the whiskers.
Subcellular Location
Virion.
Database Links

KEGG: vg:1258630

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*