Name: Recombinant Escherichia coli Outer membrane protein F (ompF)
Brand: CUSABIO
SKU: CSB-EP365808ENV

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

ompF

Uniprot No.

P02931

Research Area

Others

Alternative Names

ompF; cmlB; coa; cry; tolF; b0929; JW0912; Outer membrane porin F; Outer membrane protein 1A; Outer membrane protein B; Outer membrane protein F; Outer membrane protein IA; Porin OmpF

Species

Escherichia coli (strain K12)

Source

E.coli

Expression Region

23-362aa

Target Protein Sequence

AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

44.1 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Recombinant E.coli K12 ompF protein is an E.coli-expressed protein (Full Length of Mature Protein). Molecularly, this ompF protein is characterized by N-terminal 10xHis tag and C-terminal Myc tag, internal E.coli K12 ompF DNA fragment (23-362aa). Standard methods for recombinant ompF protein expression comprise transfecting cells with DNA vectors that consist of specific templates and then cultures cells to translate and transcribe the ompF protein production process. Typically, these cells are lysed to extract expressed proteins for more purification. The purity of this recombinant ompF protein is 85%+ measured by SDS-PAGE.

The porin ompF is a trimeric integral membrane protein that contributes to the passive diffusion of small hydrophilic molecules, such as nutrients, antibiotics, and toxic salts, across the outer membrane (OM) of E.coli. ompF is expressed in response to environmental changes such as temperature, osmolarity, nutrients availability, and toxic compounds through transcriptional and post-transcriptional modulation-involved signaling pathways. Group A colicins insert the translocation and active domains via ompF pores, allowing for the exertion of their cytotoxic action. Colicin N uses ompF both as receptor and translocator for its import.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

I would like the following protein CSB-EP365808ENV and want to know the following:
I would like to know if it is possible to request for a specific tag.
I intend to perform gold-labelling using NiNTA-tagged gold beads, hence my interest to have a polyHis tag on OmpF.
Can we also chose if the tagging is C or N terminal ?

Thanks for your inquiry.
The tag of CSB-EP365808ENV is N-terminal 10xHis-tagged and C-terminal Myc-tagged, it contains polyHis at the N-terminal but it also contains Myc-tag at the C-termina,
Can you accept C-terminal tag or only needs the tag at the N-terminal or C-terminal ?
Please clearly list the tag if you have specified tag, we can try to prepare the protein according to your demand, but it's 100% guaranteed.

Target Background

Function

Forms pores that allow passive diffusion of small molecules across the outer membrane.; (Microbial infection) It is also a receptor for the bacteriophage T2. Is the major receptor for colicin E5.; (Microbial infection) A mixed OmpC-OmpF heterotrimer is the outer membrane receptor for toxin CdiA-EC536; polymorphisms in extracellular loops 4 and 5 of OmpC confer susceptibility to CdiA-EC536-mediated toxicity.

Gene References into Functions

Trimeric porins, such as ompF, have specific lipopolysaccharide binding sites that are essential for porin biogenesis. PMID: 27493217
Klebsiella pneumoniae OmpK35 and OmpK36 produced larger more permeable channels than their Escherichia coli homologs OmpF and OmpC. PMID: 27645385
Two different centered monoclinic crystals of the E. coli outer-membrane protein OmpF originate from the same building block PMID: 26620074
The site of lipopolysaccharide binding means that ColN will preferably bind at the interface and thus position itself close to the surface of its translocon component, OmpF. PMID: 24589252
they studied how the bacteriocin colicin E9 (ColE9) assembles a cytotoxic translocon at the surface of Escherichia coli that incorporates the trimeric porin OmpF. PMID: 23812713
Presence of ordered aliphatic chains close to a positively charged area on the porin surface suggests a position for a lipopolysaccharide binding site on the surface of the major E. coli porins. PMID: 22484237
Data report the structure of the OmpF-OBS1 complex that shows the colicin bound within the porin lumen spanning the membrane bilayer. PMID: 21098297
This D37V mutant expressed reduced cation selectivity, in agreement with the view that D37 in wild-type OmpF is fully ionized, i.e., deprotonated. PMID: 20521145
HPA3P, an analogue of the antimicrobial peptide HP(2-20) isolated from the N-terminal region of the Helicobacter pylori ribosomal protein interacts with OmpF in a voltage- and concentration-dependent manner. PMID: 20180000
These data suggest that OmpF plays a key role in the transportation of positively charged polypyridyl chlororuthenium complexes into E. coli. PMID: 20176402
Separate pathways of anions and cations across the constriction zone of the OmpF pore. PMID: 19932117
study shows that quite different factors account for the selectivity of large channels. The elucidation of these factors is essential for understanding large channel selectivity and its regulation in vivo. PMID: 19134471
deletions of single extracellular loops affect pH sensitivity but not voltage dependence; study has provided some clues on the molecular determinants that underlie two major forms of modulation of OmpF porin activity by transmembrane voltage and acidic pH PMID: 15469993
for the classical porins OmpF and OmpC, our results show that the Cpx envelope stress response system plays a role in regulating their expression PMID: 16077119
OmpR allows distinct stepwise regulation of ompF and ompC transcription, which minimizes their overlapping expression upon changes in the medium osmolarity to achieve the reciprocal expression of ompF and ompC PMID: 16618701
D127 is not a key residue in the control mechanism of the voltage-dependent gating of OmpF PMID: 16858566
OmpF or OmpC can function in the translocon complex of the colicin E2 R-domain and its BtuB receptor PMID: 17548346
Colicin is closely associated with the OmpF-lipid interface, providing evidence that this peripheral pathway may play a role in colicin transmembrane transport. PMID: 18334212
The incremental electron density could be modelled as an extended poly-glycine peptide of at least seven residues. It overlapped the Mg2+ binding site obtained without T83, explaining the absence of peptide binding in the presence of Mg2+. PMID: 18636093

Hide All

Subcellular Location

Cell outer membrane; Multi-pass membrane protein.

Protein Families

Gram-negative porin family

Database Links

KEGG: ecj:JW0912

STRING: 316385.ECDH10B_0999

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address