Recombinant Escherichia coli Outer membrane protein F(ompF)

Code CSB-EP365808ENV
Product Type Recombinant Protein
Size US$2466
Uniprot No. P02931
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Species Escherichia coli (strain K12)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Research Area Others
Source E.coli
Gene Names ompF
Protein Names Recommended name: Outer membrane protein FAlternative name(s): Outer membrane protein 1A Outer membrane protein B Outer membrane protein IA Porin OmpF
Expression Region 23-362aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 44.1 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Forms pores that allow passive diffusion of small molecules across the outer membrane. It is also a receptor for the bacteriophage T2.
Subcellular Location Cell outer membrane, Multi-pass membrane protein
Protein Families Gram-negative porin family
Database Links

KEGG: ecj:JW0912

STRING: 316385.ECDH10B_0999

Q&A and Customer Reviews

Q&A
Q:

I would like the following protein CSB-EP365808ENV and want to know the following:
I would like to know if it is possible to request for a specific tag.
I intend to perform gold-labelling using NiNTA-tagged gold beads, hence my interest to have a polyHis tag on OmpF.
Can we also chose if the tagging is C or N terminal ?

A:
Thanks for your inquiry.
The tag of CSB-EP365808ENV is N-terminal 10xHis-tagged and C-terminal Myc-tagged, it contains polyHis at the N-terminal but it also contains Myc-tag at the C-termina,
Can you accept C-terminal tag or only needs the tag at the N-terminal or C-terminal ?
Please clearly list the tag if you have specified tag, we can try to prepare the protein according to your demand, but it's 100% guaranteed.
Customer Reviews

Related Products

ompF Antibodies

ompF Antibodies for Escherichia coli (strain K12)

ompF Proteins

ompF Proteins for Escherichia coli (strain K12)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.