Recombinant Escherichia coli Outer membrane protein F (ompF)

In Stock
Code CSB-EP365808ENV
Abbreviation Recombinant E.coli ompF protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
ompF
Uniprot No.
Research Area
Others
Alternative Names
ompF; cmlB; coa; cry; tolF; b0929; JW0912; Outer membrane porin F; Outer membrane protein 1A; Outer membrane protein B; Outer membrane protein F; Outer membrane protein IA; Porin OmpF
Species
Escherichia coli (strain K12)
Source
E.coli
Expression Region
23-362aa
Target Protein Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
44.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant E.coli K12 ompF protein is an E.coli-expressed protein (Full Length of Mature Protein). Molecularly, this ompF protein is characterized by N-terminal 10xHis tag and C-terminal Myc tag, internal E.coli K12 ompF DNA fragment (23-362aa). Standard methods for recombinant ompF protein expression comprise transfecting cells with DNA vectors that consist of specific templates and then cultures cells to translate and transcribe the ompF protein production process. Typically, these cells are lysed to extract expressed proteins for more purification. The purity of this recombinant ompF protein is 85%+ measured by SDS-PAGE.

The porin ompF is a trimeric integral membrane protein that contributes to the passive diffusion of small hydrophilic molecules, such as nutrients, antibiotics, and toxic salts, across the outer membrane (OM) of E.coli. ompF is expressed in response to environmental changes such as temperature, osmolarity, nutrients availability, and toxic compounds through transcriptional and post-transcriptional modulation-involved signaling pathways. Group A colicins insert the translocation and active domains via ompF pores, allowing for the exertion of their cytotoxic action. Colicin N uses ompF both as receptor and translocator for its import.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

I would like the following protein CSB-EP365808ENV and want to know the following:
I would like to know if it is possible to request for a specific tag.
I intend to perform gold-labelling using NiNTA-tagged gold beads, hence my interest to have a polyHis tag on OmpF.
Can we also chose if the tagging is C or N terminal ?

A:
Thanks for your inquiry.
The tag of CSB-EP365808ENV is N-terminal 10xHis-tagged and C-terminal Myc-tagged, it contains polyHis at the N-terminal but it also contains Myc-tag at the C-termina,
Can you accept C-terminal tag or only needs the tag at the N-terminal or C-terminal ?
Please clearly list the tag if you have specified tag, we can try to prepare the protein according to your demand, but it's 100% guaranteed.

Target Background

Function
Forms pores that allow passive diffusion of small molecules across the outer membrane.; (Microbial infection) It is also a receptor for the bacteriophage T2. Is the major receptor for colicin E5.; (Microbial infection) A mixed OmpC-OmpF heterotrimer is the outer membrane receptor for toxin CdiA-EC536; polymorphisms in extracellular loops 4 and 5 of OmpC confer susceptibility to CdiA-EC536-mediated toxicity.
Gene References into Functions
  1. Trimeric porins, such as ompF, have specific lipopolysaccharide binding sites that are essential for porin biogenesis. PMID: 27493217
  2. Klebsiella pneumoniae OmpK35 and OmpK36 produced larger more permeable channels than their Escherichia coli homologs OmpF and OmpC. PMID: 27645385
  3. Two different centered monoclinic crystals of the E. coli outer-membrane protein OmpF originate from the same building block PMID: 26620074
  4. The site of lipopolysaccharide binding means that ColN will preferably bind at the interface and thus position itself close to the surface of its translocon component, OmpF. PMID: 24589252
  5. they studied how the bacteriocin colicin E9 (ColE9) assembles a cytotoxic translocon at the surface of Escherichia coli that incorporates the trimeric porin OmpF. PMID: 23812713
  6. Presence of ordered aliphatic chains close to a positively charged area on the porin surface suggests a position for a lipopolysaccharide binding site on the surface of the major E. coli porins. PMID: 22484237
  7. Data report the structure of the OmpF-OBS1 complex that shows the colicin bound within the porin lumen spanning the membrane bilayer. PMID: 21098297
  8. This D37V mutant expressed reduced cation selectivity, in agreement with the view that D37 in wild-type OmpF is fully ionized, i.e., deprotonated. PMID: 20521145
  9. HPA3P, an analogue of the antimicrobial peptide HP(2-20) isolated from the N-terminal region of the Helicobacter pylori ribosomal protein interacts with OmpF in a voltage- and concentration-dependent manner. PMID: 20180000
  10. These data suggest that OmpF plays a key role in the transportation of positively charged polypyridyl chlororuthenium complexes into E. coli. PMID: 20176402
  11. Separate pathways of anions and cations across the constriction zone of the OmpF pore. PMID: 19932117
  12. study shows that quite different factors account for the selectivity of large channels. The elucidation of these factors is essential for understanding large channel selectivity and its regulation in vivo. PMID: 19134471
  13. deletions of single extracellular loops affect pH sensitivity but not voltage dependence; study has provided some clues on the molecular determinants that underlie two major forms of modulation of OmpF porin activity by transmembrane voltage and acidic pH PMID: 15469993
  14. for the classical porins OmpF and OmpC, our results show that the Cpx envelope stress response system plays a role in regulating their expression PMID: 16077119
  15. OmpR allows distinct stepwise regulation of ompF and ompC transcription, which minimizes their overlapping expression upon changes in the medium osmolarity to achieve the reciprocal expression of ompF and ompC PMID: 16618701
  16. D127 is not a key residue in the control mechanism of the voltage-dependent gating of OmpF PMID: 16858566
  17. OmpF or OmpC can function in the translocon complex of the colicin E2 R-domain and its BtuB receptor PMID: 17548346
  18. Colicin is closely associated with the OmpF-lipid interface, providing evidence that this peripheral pathway may play a role in colicin transmembrane transport. PMID: 18334212
  19. The incremental electron density could be modelled as an extended poly-glycine peptide of at least seven residues. It overlapped the Mg2+ binding site obtained without T83, explaining the absence of peptide binding in the presence of Mg2+. PMID: 18636093

Show More

Hide All

Subcellular Location
Cell outer membrane; Multi-pass membrane protein.
Protein Families
Gram-negative porin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*