Recombinant Escherichia coli O6:H1 Peptidyl-prolyl cis-trans isomerase A(ppiA)

In Stock
Code CSB-EP365318EGX
Product Type Recombinant Protein
Size US$2466
Uniprot No. P0AFL4
Lead Time 3-7 business days
Relevance PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Cyclophilin A Rotamase A
Species Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence AKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVILSAKVLP
Research Area Immunology
Source E.coli
Gene Names ppiA
Protein Names Recommended name: Peptidyl-prolyl cis-trans isomerase A Short name= PPIase A EC= 5.2.1.8 Alternative name(s): Cyclophilin A Rotamase A
Expression Region 25-190aa
Tag Info N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Mol. Weight 38.1kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).
Subcellular Location Periplasm
Protein Families Cyclophilin-type PPIase family
Database Links

KEGG: ecc:c4138

STRING: 199310.c4138

Pathway Necroptosis

Related Products

ppiA Antibodies

ppiA Antibodies for Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

ppiA Proteins

ppiA Proteins for Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.