Recombinant Escherichia coli Outer membrane protein C(ompC)

In Stock
Code CSB-EP356994ENV
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P06996
Relevance Forms pores that allow passive diffusion of small molecules across the outer mbrane.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP356994ENV could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) ompC.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP356994ENV could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) ompC.
Storage Buffer Tris-based buffer,50% glycerol
Alias Outer membrane protein 1BPorin OmpC
Species Escherichia coli (strain K12)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF
Research Area Others
Source E.coli
Gene Names ompC
Expression Region 22-367aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 54.3kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Forms pores that allow passive diffusion of small molecules across the outer membrane.
Subcellular Location Cell outer membrane, Multi-pass membrane protein
Protein Families Gram-negative porin family
Database Links

KEGG: ecj:JW2203

STRING: 316385.ECDH10B_2372

Q&A and Customer Reviews

Q&A
Q:

Because this protein is a several-times transmembrane protein, is there any particular reason why it isn't being expressed by the cell-free system? I was wondering if the protein should be provided in non-ionic detergent such as 0.03% n-OPE. What are your thoughts?

A:
Very nice to receive your inquiry.
Yes, you're right, this is several-times transmembrane protein, but this is a self protein of E.coli, Literature for your reference: https://amb-express.springeropen.com/articles/10.1186/s13568-017-0452-8
In addition, we have already successfully developed some related proteins, please check them as follows, so this is just a special case that we choose the regular four expression systems to express this several-times transmembrane protein, becasue we think there is no difficulty to express this protein especially with E.coli expression system.
In addition, we evaluate that if choosing cell free expression system, the cost is relatively high and the yield will be very low, so we don't think it's a good choice.
The general detergent of transmembrane proteins will be depended on the specific circumstances, but we generally use anionic surfactants for E.coli system, such as: skl (alias: sodium lauroylsarcosine; Sodium N-lauroylsarcosine;), or Non-ionic surfactants such as tritonx-100. However, you are assured that the final product form we provide is soluble.
Recombinant Escherichia coli Outer membrane protein C(ompC)
CSB-EP356994ENV >> E.coli N-terminal 6xHis-SUMO-tagged
CSB-EP356994ENVa0 >>E.coli N-terminal 6xHis-tagged
CSB-EP356994ENVe1 >> E.coli NO-tagged
Expression Region: 22-367aa; Full length of the mature protein.
Sequence:

AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF


Q:

Could you please let me know the exact composition of the Tris-based buffer for this product? Thanks for your help.

A:
Thanks for your inquiry. The composition of the Tris-based buffer is 10 mM Tris-HCl, 1 mM EDTA, pH 8.0, 50% glycerol. Have a nice day~
Customer Reviews

Related Products

ompC Antibodies

ompC Antibodies for Escherichia coli (strain K12)

ompC Proteins

ompC Proteins for Escherichia coli (strain K12)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.