Name: Recombinant Escherichia coli Outer membrane protein C (ompC)
Brand: CUSABIO
SKU: CSB-EP356994ENV

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

ompC

Uniprot No.

P06996

Research Area

Others

Alternative Names

ompC; meoA; par; b2215; JW2203; Outer membrane porin C; Outer membrane protein 1B; Outer membrane protein C; Porin OmpC

Species

Escherichia coli (strain K12)

Source

E.coli

Expression Region

22-367aa

Target Protein Sequence

AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

54.3kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

Because this protein is a several-times transmembrane protein, is there any particular reason why it isn't being expressed by the cell-free system? I was wondering if the protein should be provided in non-ionic detergent such as 0.03% n-OPE. What are your thoughts?

Very nice to receive your inquiry.
Yes, you're right, this is several-times transmembrane protein, but this is a self protein of E.coli, Literature for your reference: https://amb-express.springeropen.com/articles/10.1186/s13568-017-0452-8
In addition, we have already successfully developed some related proteins, please check them as follows, so this is just a special case that we choose the regular four expression systems to express this several-times transmembrane protein, becasue we think there is no difficulty to express this protein especially with E.coli expression system.
In addition, we evaluate that if choosing cell free expression system, the cost is relatively high and the yield will be very low, so we don't think it's a good choice.
The general detergent of transmembrane proteins will be depended on the specific circumstances, but we generally use anionic surfactants for E.coli system, such as: skl (alias: sodium lauroylsarcosine; Sodium N-lauroylsarcosine;), or Non-ionic surfactants such as tritonx-100. However, you are assured that the final product form we provide is soluble.
Recombinant Escherichia coli Outer membrane protein C(ompC)
CSB-EP356994ENV >> E.coli N-terminal 6xHis-SUMO-tagged
CSB-EP356994ENVa0 >>E.coli N-terminal 6xHis-tagged
CSB-EP356994ENVe1 >> E.coli NO-tagged
Expression Region: 22-367aa; Full length of the mature protein.
Sequence:

Could you please let me know the exact composition of the Tris-based buffer for this product? Thanks for your help.

Thanks for your inquiry. The composition of the Tris-based buffer is 10 mM Tris-HCl, 1 mM EDTA, pH 8.0, 50% glycerol. Have a nice day~

Target Background

Function

Forms pores that allow passive diffusion of small molecules across the outer membrane.; (Microbial infection) Supports colicin E5 entry in the absence of its major receptor OmpF.; (Microbial infection) A mixed OmpC-OmpF heterotrimer is the outer membrane receptor for toxin CdiA-EC536; polymorphisms in extracellular loops 4 and 5 of OmpC confer susceptibility to CdiA-EC536-mediated toxicity.

Gene References into Functions

Studied the rate of entry (association) and exit (dissociation) of six antibiotics to/from reconstituted E. coli porin OmpC. WaterMap was used to estimate the total water transfer energies resulting from transient occupation by each antibiotic. PMID: 23011778
X ray structure of OmpC complexed with lactoferrin PMID: 16511154

Subcellular Location

Cell outer membrane; Multi-pass membrane protein.

Protein Families

Gram-negative porin family

Database Links

KEGG: ecj:JW2203

STRING: 316385.ECDH10B_2372

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address