Recombinant Human Tubulinyl-Tyr carboxypeptidase 2 (VASH2)

In Stock
Code CSB-EP769783HU
Abbreviation Recombinant Human VASH2 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP769783HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) VASH2.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP769783HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) VASH2.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
FLJ12505; OTTHUMP00000035013; OTTHUMP00000035017; OTTHUMP00000228345; OTTHUMP00000228346; OTTHUMP00000228347; RP11-275G3.1; VASH2; VASH2_HUMAN; Vasohibin-2; Vasohibin-like protein
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-355aa
Target Protein Sequence
MTGSAADTHRCPHPKGAKGTRSRSSHARPVSLATSGGSEEEDKDGGVLFHVNKSGFPIDSHTWERMWMHVAKVHPKGGEMVGAIRNAAFLAKPSIPQVPNYRLSMTIPDWLQAIQNYMKTLQYNHTGTQFFEIRKMRPLSGLMETAKEMTRESLPIKCLEAVILGIYLTNGQPSIERFPISFKTYFSGNYFHHVVLGIYCNGRYGSLGMSRRAELMDKPLTFRTLSDLIFDFEDSYKKYLHTVKKVKIGLYVPHEPHSFQPIEWKQLVLNVSKMLRADIRKELEKYARDMRMKILKPASAHSPTQVRSRGKSLSPRRRQASPPRRLGRREKSPALPEKKVADLSTLNEVGYQIRI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
56.4kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The region for expressing recombinant Human VASH2 contains amino acids 1-355. This VASH2 protein is expected to have a theoretical molecular weight of 56.4 kDa. This protein is generated in a e.coli-based system. Fusion of the N-terminal 6xHis-SUMO tag into the VASH2 encoding gene fragment was conducted, allowing for easier detection and purification of the VASH2 protein in subsequent stages.

Human vasohibin-2 (VASH2) serves as a critical regulator in angiogenesis, influencing blood vessel formation. Its main function involves inhibiting endothelial cell proliferation and migration, exerting anti-angiogenic effects. In cardiovascular research, VASH2 contributes to understanding vascular homeostasis and potential therapeutic interventions for angiogenesis-related diseases. Additionally, VASH2 is implicated in cancer biology, where its role in angiogenesis may impact tumor growth and metastasis. Investigating VASH2 provides insights into vascular development, angiogenic disorders, and cancer progression, offering potential applications in cardiovascular medicine and oncology.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Tyrosine carboxypeptidase that removes the C-terminal tyrosine residue of alpha-tubulin, thereby regulating microtubule dynamics and function. Critical for spindle function and accurate chromosome segregation during mitosis since microtuble detyronisation regulates mitotic spindle length and postioning. Acts as an activator of angiogenesis: expressed in infiltrating mononuclear cells in the sprouting front to promote angiogenesis. Plays a role in axon formation.
Gene References into Functions
  1. VASH2 may promote drug resistance of breast cancer cells through regulating ABCG2 via the AKT signaling pathway. PMID: 29039601
  2. These results suggest that VASH-2 could play an important role in the pathogenesis of renal diseases, and that VASH-2 is closely associated with hypertension and impaired glucose tolerance. PMID: 29042694
  3. VASH1 and VASH2 but not SVBP alone, increased detyrosination of -tubulin, and purified vasohibins removed the C-terminal tyrosine of -tubulin. PMID: 29146869
  4. These results suggest that VASH2 plays an important role in gastric tumor progression via the accumulation of cancer-associated fibroblasts PMID: 28960674
  5. The present study suggests a protective effect of miR-200b/c on high glucose induced human retinal microvascular endothelial cell line dysfunction by inhibiting VASH2. PMID: 28882646
  6. VASH2 expression is positively correlated with FGF2 expression and promotes angiogenesis in human luminal breast cancer by transcriptional activation of fibroblast growth factor 2 through non-paracrine mechanisms. PMID: 27702660
  7. These data suggest that VASH2 reduces the chemosensitivity to gemcitabine in pancreatic cancer cells via JUN-dependent transactivation of RRM2. PMID: 28327155
  8. identified a novel UPS regulatory system in which essential domain architecture (VASH-PS) of VASHs, comprising regions VASH191-180 and VASH280-169 , regulate the cytosolic punctate structure formation in the absence of SVBP. PMID: 27879017
  9. The results indicate that VASH2 played a significant role in the epithelial-mesenchymal transition by modulating the TGF-beta signaling. PMID: 28064471
  10. to the best of our knowledge, these results are the first clinical data indicating that nuclear VASH2, but not cytoplasmic VASH2, promotes cell proliferation by driving the cell cycle from the G0/G1 to S phase. PMID: 26177649
  11. MiR200-upregulated Vasohibin 2 promotes the malignant transformation of tumors by inducing epithelial-mesenchymal transition in hepatocellular carcinoma PMID: 25269476
  12. Suggest that overexpression of VASH2 in pancreatic ductal adenocarcinoma accelerated the pace of tumor development toward a more serious malignant phenotype and was associated with a poor clinical outcome. PMID: 25916042
  13. VASH1 and VASH2 showed distinctive localization and opposing function on the fetoplacental vascularization. PMID: 25184477
  14. VASH2 overexpression downregulated wild-type p53. PMID: 24595063
  15. VASH2 expressed in serous ovarian carcinoma cells promoted tumor growth and peritoneal dissemination by promoting angiogenesis. PMID: 22826464
  16. This is the first study to report differences in the intracellular localization of the VASH2 protein and, hence, a new research direction on the study of VASH2 PMID: 23615928
  17. vasohibin-1 and vasohibin-2 mRNA are expressed in gastric cancer cells and in tumor-associated macrophages (TAMs), and their expressions are altered by hypoxia. PMID: 22438034
  18. VASH2 contributes to the angiogenesis in hepatocellular carcinoma via an Small vasohibin binding protein-mediated paracrine mechanism. PMID: 22614011
  19. Data suggest that VASH1 is expressed in vascular endothelium to terminate angiogenesis; VASH2 appears to be expressed in other cells (primarily mononuclear leukocytes) to promote angiogenesis. [REVIEW] PMID: 23100270

Show More

Hide All

Subcellular Location
Cytoplasm. Secreted. Cytoplasm, cytoskeleton.
Protein Families
Vasohibin family
Database Links

HGNC: 25723

OMIM: 610471

KEGG: hsa:79805

UniGene: Hs.96885

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*