Recombinant Human MHC Class I chain-related protein (MICA), partial (Active)

In Stock
Code CSB-MP5605HU
Abbreviation Recombinant Human MICA protein, partial (Active)
MSDS
Size $104
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA.Immobilized Human MICA at 2 μg/ml can bind Anti-MICA/B recombinant antibody (CSB-RA56059MA1HU). The EC50 is 0.6924-0.9195 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Human MICA at 2 μg/mL can bind Anti-MICA/B recombinant antibody (CSB-RA56059MA1HU). The EC50 is 0.6924-0.9195 ng/mL.
Target Names
Uniprot No.
Alternative Names
MHC Class I chain-related protein; MHC class I polypeptide-related sequence A; MICA
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
24-309aa
Target Protein Sequence
EPHSLRYNLTVLSGDGSVQSGFLAEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQT
Mol. Weight
34.1 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

MICA functions as a stress-induced ligand for the activating receptor NKG2D on natural killer cells and CD8+ T cells, making it a critical node in immune surveillance and tumor immunology. This mammalian-expressed construct spanning residues 24–309 captures the complete extracellular domain, preserving the native glycosylation and disulfide architecture required for physiological NKG2D engagement. Functional ELISA validation demonstrates specific antibody binding with an EC50 of 0.69–0.92 ng/mL, confirming conformational integrity suitable for therapeutic antibody epitope mapping, competitive inhibition screening of NKG2D-blocking biologics, and ligand-receptor interaction studies by surface plasmon resonance or biolayer interferometry. The protein meets the purity (>95% by SDS-PAGE) and endotoxin (<1.0 EU/μg) thresholds commonly required for cell-based assays investigating MICA shedding mechanisms, tumor immune evasion pathways, and antibody-dependent cellular cytotoxicity in NK cell activation models.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*