Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA.Immobilized Human MICA at 2 μg/mL can bind Anti-MICA/B recombinant antibody (CSB-RA56059MA1HU). The EC50 is 0.6924-0.9195 ng/mL.

Target Names

MICA

Uniprot No.

J9TPG6

Alternative Names

MHC Class I chain-related protein; MHC class I polypeptide-related sequence A; MICA

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

24-309aa

Target Protein Sequence

EPHSLRYNLTVLSGDGSVQSGFLAEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQT

Mol. Weight

34.1 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

MICA functions as a stress-induced ligand for the activating receptor NKG2D on natural killer cells and CD8+ T cells, making it a critical node in immune surveillance and tumor immunology. This mammalian-expressed construct spanning residues 24–309 captures the complete extracellular domain, preserving the native glycosylation and disulfide architecture required for physiological NKG2D engagement. Functional ELISA validation demonstrates specific antibody binding with an EC50 of 0.69–0.92 ng/mL, confirming conformational integrity suitable for therapeutic antibody epitope mapping, competitive inhibition screening of NKG2D-blocking biologics, and ligand-receptor interaction studies by surface plasmon resonance or biolayer interferometry. The protein meets the purity (>95% by SDS-PAGE) and endotoxin (<1.0 EU/μg) thresholds commonly required for cell-based assays investigating MICA shedding mechanisms, tumor immune evasion pathways, and antibody-dependent cellular cytotoxicity in NK cell activation models.

Code	CSB-MP5605HU
Abbreviation	Recombinant Human MICA protein, partial (Active)
MSDS	MSDS Datasheet
Size	$104
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA.Immobilized Human MICA at 2 μg/ml can bind Anti-MICA/B recombinant antibody (CSB-RA56059MA1HU). The EC₅₀ is 0.6924-0.9195 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human MHC Class I chain-related protein (MICA), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

×CloseMessage