Recombinant Human 5-hydroxytryptamine receptor 1F(HTR1F), partial

Product Type Recombinant Protein
Uniprot No. P30939
Species Homo sapiens (Human)
Gene Names HTR1F
Protein Names Recommended name: 5-hydroxytryptamine receptor 1F Short name= 5-HT-1F Short name= 5-HT1FAlternative name(s): Serotonin receptor 1F
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various alkaloids and psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

HGNC: 5292

OMIM: 182134

KEGG: hsa:3355

STRING: 9606.ENSP00000322924

UniGene: Hs.248136

Pathway cAMP signaling pathway

Product Details for Different Expression Systems

Product Name Recombinant Human 5-hydroxytryptamine receptor 1F(HTR1F), partial,Yeast
Code CSB-YP010886HU1
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence YKIYRAAKTLYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKI HSTVRSLRSEFKHEKSWRRQKISGTRERK
Expression Region 202-290aa
Protein Description Partial
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Human 5-hydroxytryptamine receptor 1F(HTR1F), partial,E.coli
Code CSB-EP010886HU1
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence YKIYRAAKTLYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKI HSTVRSLRSEFKHEKSWRRQKISGTRERK
Expression Region 202-290aa
Protein Description Partial
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Human 5-hydroxytryptamine receptor 1F(HTR1F), partial,Baculovirus
Code CSB-BP010886HU1
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence YKIYRAAKTLYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKI HSTVRSLRSEFKHEKSWRRQKISGTRERK
Expression Region 202-290aa
Protein Description Partial
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Human 5-hydroxytryptamine receptor 1F(HTR1F), partial,Mammalian cell
Code CSB-MP010886HU1
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence YKIYRAAKTLYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKI HSTVRSLRSEFKHEKSWRRQKISGTRERK
Expression Region 202-290aa
Protein Description Partial
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

HTR1F Antibodies

HTR1F Antibodies for Homo sapiens (Human)

HTR1F Proteins

HTR1F Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.