Recombinant Human ADP/ATP translocase 3 (SLC25A6), partial

In Stock
Code CSB-EP021520HU1
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
SLC25A6
Uniprot No.
Research Area
Cell Biology
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
232-272aa
Target Protein Sequence
DTVRRRMMMQSGRKGADIMYTGTVDCWRKIFRDEGGKAFFK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
20.2 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-KSI-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The process of synthesizing the recombinant Human SLC25A6 protein includes transfecting e.coli cells with a DNA expression vector containing the gene for the desired protein (232-272aa). Subsequently, the cells are cultured to induce the expression of the intended protein. The protein is fused with a N-terminal 6xHis-KSI tag. The recombinant Human SLC25A6 protein is then collected and purified from the cell lysate through affinity purification. It exhibits a purity exceeding 85%, as verified by SDS-PAGE.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : / Sample species: cells

Review: Recombinant human protein ADP/ATP translocase 3 (ANT3) was obtained from CUSABIO to confirm an in vitro interaction of DNAJA1. Decreased expression of ANT3 has been implicated in resistance to TNF-α-induced cell death and the increased production and resistance to reactive oxygen species (ROS).

By Anonymous

Target Background

Function
ADP:ATP antiporter that mediates import of ADP into the mitochondrial matrix for ATP synthesis, and export of ATP out to fuel the cell. Cycles between the cytoplasmic-open state (c-state) and the matrix-open state (m-state): operates by the alternating access mechanism with a single substrate-binding site intermittently exposed to either the cytosolic (c-state) or matrix (m-state) side of the inner mitochondrial membrane. In addition to its ADP:ATP antiporter activity, also involved in mitochondrial uncoupling and mitochondrial permeability transition pore (mPTP) activity. Plays a role in mitochondrial uncoupling by acting as a proton transporter: proton transport uncouples the proton flows via the electron transport chain and ATP synthase to reduce the efficiency of ATP production and cause mitochondrial thermogenesis. Proton transporter activity is inhibited by ADP:ATP antiporter activity, suggesting that SLC25A6/ANT3 acts as a master regulator of mitochondrial energy output by maintaining a delicate balance between ATP production (ADP:ATP antiporter activity) and thermogenesis (proton transporter activity). Proton transporter activity requires free fatty acids as cofactor, but does not transport it. Also plays a key role in mPTP opening, a non-specific pore that enables free passage of the mitochondrial membranes to solutes of up to 1.5 kDa, and which contributes to cell death. It is however unclear if SLC25A6/ANT3 constitutes a pore-forming component of mPTP or regulates it.
Gene References into Functions
  1. Human ANT3 expression is directly downregulated by overexpression of hcmv-miR-UL36-5p. PMID: 26212361
  2. The dynamics of the molecular interactions between the C-terminal region of PB1-F2 protein and VDAC1 and ANT3 were expounded by employing an in silico approach. PMID: 19669810
  3. Of three ANT isoforms expressed in yeast, ANC3 is the most efficient to restore yeast growth on a nonfermentable carbon source of a yeast mutant strain lacking its three endogenous ANC. PMID: 12450408
  4. Results demonstrate that induction of adenine nucleotide translocase 3 by interleukin-4 and interferon-gamma proceeds via pathways involving STAT6 and STAT1, respectively. PMID: 14746803
  5. ANT3 overexpression induces apoptosis in cultured cells. PMID: 15063741
  6. ANT3 has a potential role in T-helper cell survival and immune cell homeostasis. PMID: 16930576
  7. involvement of ANT in cell death is cell type- and stimulus-dependent PMID: 17855512
  8. These data suggest that the down-regulation of ANT3 levels upon stimulation with CPT may be involved in the molecular mechanism underlying acquired resistance to camptothecin. PMID: 19111545

Show More

Hide All

Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein.
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Tissue Specificity
Expressed in erythrocytes (at protein level).
Database Links

HGNC: 10992

OMIM: 300151

KEGG: hsa:293

STRING: 9606.ENSP00000370808

UniGene: Hs.350927

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*