Recombinant Human Acetylcholine receptor subunit alpha (CHRNA1), partial

Code CSB-BP005386HU
Abbreviation Recombinant Human CHRNA1 protein, partial
MSDS
Size $317
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Neuroscience
Species
Homo sapiens (Human)
Source
Baculovirus
Expression Region
21-255aa
Target Protein Sequence
SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.7 kDa
Protein Length
Partial of Isoform 2
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant human acetylcholine receptor subunit alpha (CHRNA1) comes from a baculovirus expression system and spans amino acids 21 to 255 of the protein. A C-terminal 6xHis tag is included to make purification and detection more straightforward. The product achieves high purity levels—over 90% as confirmed by SDS-PAGE—which should provide reliable results in research settings.

The acetylcholine receptor subunit alpha (CHRNA1) plays a central role in acetylcholine receptor formation, making it crucial for neuromuscular junction signaling. This subunit helps bind acetylcholine, which enables neurotransmission to occur. Studying CHRNA1 appears essential for grasping how muscle activation works and may prove critical in research on neuromuscular diseases and synaptic physiology.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant Human CHRNA1 is expressed in a Baculovirus expression system (insect cells), which is a eukaryotic system capable of producing properly folded proteins with some post-translational modifications. The protein is expressed as a partial fragment (21-255aa) representing approximately 90% of the mature protein but lacking the C-terminal transmembrane and intracellular domains. Since activity is unverified, the protein cannot be assumed to be correctly folded or bioactive. While the baculovirus system increases the probability of correct folding compared to prokaryotic systems, the absence of the full-length sequence (particularly the transmembrane domains essential for receptor function) and lack of co-expression with other receptor subunits significantly reduces the likelihood of proper nicotinic acetylcholine receptor function. The protein may be correctly folded at the domain level but is unlikely to exhibit ligand binding activity without the complete receptor complex.

1. Antibody Development and Validation Studies

This application is appropriate. The recombinant CHRNA1 fragment can serve as an effective immunogen for generating antibodies against the extracellular domain of the acetylcholine receptor alpha subunit. The C-terminal 6xHis tag facilitates purification and immobilization for screening assays. Even if the protein is not fully functional, antibodies can recognize linear epitopes. However, antibodies produced may not recognize conformational epitopes of the native, membrane-embedded receptor without validation against full-length protein.

2. Protein-Protein Interaction Studies

This application has significant limitations. While the His-tag enables technical feasibility for pull-down assays, the partial nature of the protein (lacking transmembrane domains) means it cannot authentically represent interactions that require the full receptor complex. Interactions identified may be fragment-specific and not physiologically relevant. This approach should be used with caution and results validated with full-length protein studies.

3. Biochemical Characterization and Stability Studies

This application is well-supported. The high purity makes this protein suitable for biophysical characterization (DLS, CD spectroscopy, etc.) to study the folding and stability of the CHRNA1 extracellular domain. These studies can provide valuable information about the recombinant protein's properties, even if it lacks full biological activity.

4. In Vitro Binding Assays and Ligand Screening

This application is problematic without activity verification. While the protein contains the putative ligand-binding domain, the absence of the full receptor structure and necessary subunits (β, γ, δ) means it is unlikely to exhibit native ligand binding properties. Screening for ligands using this partial fragment may yield false positives/negatives. This application should not be pursued without validating binding capability first.

Final Recommendation & Action Plan

This recombinant CHRNA1 partial fragment is most suitable for antibody development and biochemical characterization studies, where correct tertiary structure is less critical. For protein-protein interaction studies, focus on interactions specific to the extracellular domain only, with the understanding that findings may not reflect full receptor biology. Ligand binding studies should be avoided unless binding capability is first validated against known ligands. Recommended first steps include: (1) conducting biophysical analyses (circular dichroism, size exclusion chromatography) to confirm proper folding of the expressed fragment; (2) validating antibody specificity against native receptor preparations; (3) if pursuing interaction studies, using orthogonal methods to confirm any identified interactions. For functional studies, consider obtaining the full-length receptor expressed in appropriate systems.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Gene References into Functions
  1. In our analysis, we found one pair of SNPs in CHRNA1 and CHRNA7, plus one pair of SNPs in CHRNA2 and CHRNA3 reached corrected significance in tests for GxG interaction. Our study suggested evidence of interactions between CHRNs in controlling the risk of NSCL/P. PMID: 29688589
  2. This study shown that the genetic analysis revealed that the very early onset JMG had a more prominent genetic predisposition in an autoantigen gene (CHRNA1). PMID: 28364296
  3. Data suggest that the mutations made the cholinergic receptor nicotinic alpha 1 subunit channel (CHRNA1) resistant to the antagonists, not by impairing antagonist binding, but rather by producing a gain-of-function phenotype, e.g. increased agonist sensitivity. PMID: 27649498
  4. Study indicated that nicotinic acetylcholine receptor alpha 1-subunit peptides may act as receptor decoy molecules and inhibit the binding of virus to the native host cell receptors and hence may reduce viral infection. PMID: 26656837
  5. ChRnA1 gene variants did not affect the pharmacodynamics of rocuronium. PMID: 25279974
  6. nicotine contributes to the progression and erlotinib-resistance of the NSCLC xenograft model via the cooperation between nAChR and EGFR. PMID: 25670150
  7. show that AON complementary to the 5' splice site of the exon was the most effective at exon skipping of the minigene with causative mutations, as well as endogenous wild-type CHRNA1 PMID: 25888793
  8. The CHRNA1 extracellular domain is an improved protein for use in antigen-specific Myasthenia Gravis therapeutic strategies. PMID: 24376846
  9. HnRNP L and hnRNP LL antagonistically modulate PTB-mediated splicing suppression of CHRNA1 pre-mRNA. PMID: 24121633
  10. High expression of CHRNA1 is associated with lung adenocarcinoma after complete resection. PMID: 23775407
  11. No mutations were found in CHRNG, CHRND and CHRNA1 genes of Indian families with Escobar syndrome. PMID: 23448903
  12. Findings identify a novel lung cancer risk locus on 2q31.1 which correlates with CHRNA1 expression and replicate previous associations on 15q25.1 in African-Americans. PMID: 23232035
  13. V188 is functionally linked to Y190 in the C-loop and to D200 in beta-strand 10 of the acetylcholine receptor alpha subunit, which connects to the M1 transmembrane domain PMID: 22728938
  14. Studies suggest that the receptor nAChRalpha1 is an important regulator of calpain-1 activation and inflammation in the chronic hypercholesterolemic nephropathy. PMID: 20661225
  15. expression of extracellular domain of human muscle acetylcholine receptor alpha subunit in yeast Pichia pastoris PMID: 12015305
  16. DNA analysis of a father and son with dominant fast channel congenital myasthenic syndrome revealed an AChR alpha-subunit F256L missense mutation affecting channel gating PMID: 15079006
  17. A good correlation was found between the expression of PAX3/7-FKHR and AChR, while MyoD1 was more sensitive but less specific. PMID: 16435141
  18. the interaction between alpha AChR M1 and M2 domains plays a key role in channel gating PMID: 17028140
  19. growth factor-induced HMVEC migration, a key angiogenesis event, requires nAChR activation--an effect mediated in part by nAChR-dependent regulation of thioredoxin activity. PMID: 17082486
  20. Here we describe a mechanism controlling thymic transcription of a prototypic tissue-restricted human auto-antigen gene, CHRNA1 PMID: 17687331
  21. No CHRNA1, CHRNB1, or CHRND mutations were detected, but a homozygous RAPSN frameshift mutation, c.1177-1178delAA, was identified in a family with three children affected with lethal fetal akinesia sequence. PMID: 18179903
  22. study reports homozygous nonsense mutations in CHRNA1 and CHRND and shows that they were lethal PMID: 18252226
  23. Presence of heterogeneous nuclear ribonucleoprotein H-binding motif in CHRNA1 close to the 3' end of an intron is an essential but underestimated splicing regulator of the downstream exon. PMID: 18806275

Show More

Hide All

Involvement in disease
Multiple pterygium syndrome, lethal type (LMPS); Myasthenic syndrome, congenital, 1A, slow-channel (CMS1A); Myasthenic syndrome, congenital, 1B, fast-channel (CMS1B)
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-1/CHRNA1 sub-subfamily
Tissue Specificity
Isoform 1 is only expressed in skeletal muscle. Isoform 2 is constitutively expressed in skeletal muscle, brain, heart, kidney, liver, lung and thymus.
Database Links

HGNC: 1955

OMIM: 100690

KEGG: hsa:1134

STRING: 9606.ENSP00000261007

UniGene: Hs.434479

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*