Recombinant Human Acetylcholine receptor subunit alpha (CHRNA1), partial

In Stock
Code CSB-EP005386HU
Abbreviation Recombinant Human CHRNA1 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP005386HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CHRNA1.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP005386HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CHRNA1.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Transport
Alternative Names
Acetylcholine receptor subunit alpha; ACHA_HUMAN; AChR; ACHRA; ACHRD; CHNRA; Cholinergic receptor nicotinic alpha 1 subunit; Cholinergic receptor nicotinic alpha polypeptide 1; Cholinergic receptor; nicotinic; alpha polypeptide 1 (muscle); Chrna1; CMS1A; CMS1B; CMS2A; FCCMS; Nicotinic cholinergic receptor alpha 1; SCCMS; Schizophrenia neurophysiologic defect candidate
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
21-255aa
Target Protein Sequence
SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.1kDa
Protein Length
Partial of P02708-1
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Recombinant Human Acetylcholine receptor subunit alpha (CHRNA1) is a partial length protein expressed with an N-terminal 6xHis-tagged in the E.coli. Its expression region corresponds to 21-255aa (Extracellular Domain) of human CHRNA1 protein. It underwent validation via the LC-MS/MS analysis. Its purity reached up to 90% determined by SDS-PAGE. Under reducing conditions, a molecular weight band of around 32 kDa was visualized on the gel. This recombinant CHRNA1 protein is in stock now.
CHRNA1 is a component of acetylcholine receptors (AChRs) that are neurotransmitter receptors in the neuronal system. This protein plays a role in acetlycholine binding/channel gating. The ACh/AChR signaling is essential to normal the central nervous system (CNS) function. Alterations in this signaling lead to multiple neuropsychiatric disorders, including Myasthenic Syndrome, Congenital, 1B, Fast-Channel and Myasthenic Syndrome, Congenital, 1A, Slow-Channel.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Can you confirm an exact EU/ug or EU/mg for this lot? What concentration is this protein formulated at prior to lyophilization?
We are targeting a protein concentration of 0.8 mg/mL. Will the lyophilized material be soluble if we were to add water to the vial such that the protein concentration was 0.8 mg/mL?

A:

Regarding the endotoxin content of the product CSB-EP005386HU, we performed qualitative testing rather than quantitative testing, so we cannot tell you the specific endotoxin content. We are currently using an endotoxin removal kit to qualitatively detect the endotoxin content of this protein, and the endotoxin content is less than 1.0 EU/ug.
The current lot DD05427k1g0 has a concentration of 1.02mg/ml before freeze-drying. The concentrations of proteins that have been shipped before are 0.4mg/ml-1.5mg/ml, so it can meet the customer's reconstitution concentration of 0.8mg/ml.

Target Background

Function
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Gene References into Functions
  1. In our analysis, we found one pair of SNPs in CHRNA1 and CHRNA7, plus one pair of SNPs in CHRNA2 and CHRNA3 reached corrected significance in tests for GxG interaction. Our study suggested evidence of interactions between CHRNs in controlling the risk of NSCL/P. PMID: 29688589
  2. This study shown that the genetic analysis revealed that the very early onset JMG had a more prominent genetic predisposition in an autoantigen gene (CHRNA1). PMID: 28364296
  3. Data suggest that the mutations made the cholinergic receptor nicotinic alpha 1 subunit channel (CHRNA1) resistant to the antagonists, not by impairing antagonist binding, but rather by producing a gain-of-function phenotype, e.g. increased agonist sensitivity. PMID: 27649498
  4. Study indicated that nicotinic acetylcholine receptor alpha 1-subunit peptides may act as receptor decoy molecules and inhibit the binding of virus to the native host cell receptors and hence may reduce viral infection. PMID: 26656837
  5. ChRnA1 gene variants did not affect the pharmacodynamics of rocuronium. PMID: 25279974
  6. nicotine contributes to the progression and erlotinib-resistance of the NSCLC xenograft model via the cooperation between nAChR and EGFR. PMID: 25670150
  7. show that AON complementary to the 5' splice site of the exon was the most effective at exon skipping of the minigene with causative mutations, as well as endogenous wild-type CHRNA1 PMID: 25888793
  8. The CHRNA1 extracellular domain is an improved protein for use in antigen-specific Myasthenia Gravis therapeutic strategies. PMID: 24376846
  9. HnRNP L and hnRNP LL antagonistically modulate PTB-mediated splicing suppression of CHRNA1 pre-mRNA. PMID: 24121633
  10. High expression of CHRNA1 is associated with lung adenocarcinoma after complete resection. PMID: 23775407
  11. No mutations were found in CHRNG, CHRND and CHRNA1 genes of Indian families with Escobar syndrome. PMID: 23448903
  12. Findings identify a novel lung cancer risk locus on 2q31.1 which correlates with CHRNA1 expression and replicate previous associations on 15q25.1 in African-Americans. PMID: 23232035
  13. V188 is functionally linked to Y190 in the C-loop and to D200 in beta-strand 10 of the acetylcholine receptor alpha subunit, which connects to the M1 transmembrane domain PMID: 22728938
  14. Studies suggest that the receptor nAChRalpha1 is an important regulator of calpain-1 activation and inflammation in the chronic hypercholesterolemic nephropathy. PMID: 20661225
  15. expression of extracellular domain of human muscle acetylcholine receptor alpha subunit in yeast Pichia pastoris PMID: 12015305
  16. DNA analysis of a father and son with dominant fast channel congenital myasthenic syndrome revealed an AChR alpha-subunit F256L missense mutation affecting channel gating PMID: 15079006
  17. A good correlation was found between the expression of PAX3/7-FKHR and AChR, while MyoD1 was more sensitive but less specific. PMID: 16435141
  18. the interaction between alpha AChR M1 and M2 domains plays a key role in channel gating PMID: 17028140
  19. growth factor-induced HMVEC migration, a key angiogenesis event, requires nAChR activation--an effect mediated in part by nAChR-dependent regulation of thioredoxin activity. PMID: 17082486
  20. Here we describe a mechanism controlling thymic transcription of a prototypic tissue-restricted human auto-antigen gene, CHRNA1 PMID: 17687331
  21. No CHRNA1, CHRNB1, or CHRND mutations were detected, but a homozygous RAPSN frameshift mutation, c.1177-1178delAA, was identified in a family with three children affected with lethal fetal akinesia sequence. PMID: 18179903
  22. study reports homozygous nonsense mutations in CHRNA1 and CHRND and shows that they were lethal PMID: 18252226
  23. Presence of heterogeneous nuclear ribonucleoprotein H-binding motif in CHRNA1 close to the 3' end of an intron is an essential but underestimated splicing regulator of the downstream exon. PMID: 18806275

Show More

Hide All

Involvement in disease
Multiple pterygium syndrome, lethal type (LMPS); Myasthenic syndrome, congenital, 1A, slow-channel (CMS1A); Myasthenic syndrome, congenital, 1B, fast-channel (CMS1B)
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-1/CHRNA1 sub-subfamily
Tissue Specificity
Isoform 1 is only expressed in skeletal muscle. Isoform 2 is constitutively expressed in skeletal muscle, brain, heart, kidney, liver, lung and thymus.
Database Links

HGNC: 1955

OMIM: 100690

KEGG: hsa:1134

STRING: 9606.ENSP00000261007

UniGene: Hs.434479

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*