Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

CHRNA1

Uniprot No.

P02708

Research Area

Transport

Alternative Names

Acetylcholine receptor subunit alpha; ACHA_HUMAN; AChR; ACHRA; ACHRD; CHNRA; Cholinergic receptor nicotinic alpha 1 subunit; Cholinergic receptor nicotinic alpha polypeptide 1; Cholinergic receptor; nicotinic; alpha polypeptide 1 (muscle); Chrna1; CMS1A; CMS1B; CMS2A; FCCMS; Nicotinic cholinergic receptor alpha 1; SCCMS; Schizophrenia neurophysiologic defect candidate

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

21-255aa

Target Protein Sequence

SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

31.1kDa

Protein Length

Partial of P02708-1

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Recombinant Human Acetylcholine receptor subunit alpha (CHRNA1) is a partial length protein expressed with an N-terminal 6xHis-tagged in the E.coli. Its expression region corresponds to 21-255aa (Extracellular Domain) of human CHRNA1 protein. It underwent validation via the LC-MS/MS analysis. Its purity reached up to 90% determined by SDS-PAGE. Under reducing conditions, a molecular weight band of around 32 kDa was visualized on the gel. This recombinant CHRNA1 protein is in stock now.
CHRNA1 is a component of acetylcholine receptors (AChRs) that are neurotransmitter receptors in the neuronal system. This protein plays a role in acetlycholine binding/channel gating. The ACh/AChR signaling is essential to normal the central nervous system (CNS) function. Alterations in this signaling lead to multiple neuropsychiatric disorders, including Myasthenic Syndrome, Congenital, 1B, Fast-Channel and Myasthenic Syndrome, Congenital, 1A, Slow-Channel.

Target Background

Function

After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

Gene References into Functions

In our analysis, we found one pair of SNPs in CHRNA1 and CHRNA7, plus one pair of SNPs in CHRNA2 and CHRNA3 reached corrected significance in tests for GxG interaction. Our study suggested evidence of interactions between CHRNs in controlling the risk of NSCL/P. PMID: 29688589
This study shown that the genetic analysis revealed that the very early onset JMG had a more prominent genetic predisposition in an autoantigen gene (CHRNA1). PMID: 28364296
Data suggest that the mutations made the cholinergic receptor nicotinic alpha 1 subunit channel (CHRNA1) resistant to the antagonists, not by impairing antagonist binding, but rather by producing a gain-of-function phenotype, e.g. increased agonist sensitivity. PMID: 27649498
Study indicated that nicotinic acetylcholine receptor alpha 1-subunit peptides may act as receptor decoy molecules and inhibit the binding of virus to the native host cell receptors and hence may reduce viral infection. PMID: 26656837
ChRnA1 gene variants did not affect the pharmacodynamics of rocuronium. PMID: 25279974
nicotine contributes to the progression and erlotinib-resistance of the NSCLC xenograft model via the cooperation between nAChR and EGFR. PMID: 25670150
show that AON complementary to the 5' splice site of the exon was the most effective at exon skipping of the minigene with causative mutations, as well as endogenous wild-type CHRNA1 PMID: 25888793
The CHRNA1 extracellular domain is an improved protein for use in antigen-specific Myasthenia Gravis therapeutic strategies. PMID: 24376846
HnRNP L and hnRNP LL antagonistically modulate PTB-mediated splicing suppression of CHRNA1 pre-mRNA. PMID: 24121633
High expression of CHRNA1 is associated with lung adenocarcinoma after complete resection. PMID: 23775407
No mutations were found in CHRNG, CHRND and CHRNA1 genes of Indian families with Escobar syndrome. PMID: 23448903
Findings identify a novel lung cancer risk locus on 2q31.1 which correlates with CHRNA1 expression and replicate previous associations on 15q25.1 in African-Americans. PMID: 23232035
V188 is functionally linked to Y190 in the C-loop and to D200 in beta-strand 10 of the acetylcholine receptor alpha subunit, which connects to the M1 transmembrane domain PMID: 22728938
Studies suggest that the receptor nAChRalpha1 is an important regulator of calpain-1 activation and inflammation in the chronic hypercholesterolemic nephropathy. PMID: 20661225
expression of extracellular domain of human muscle acetylcholine receptor alpha subunit in yeast Pichia pastoris PMID: 12015305
DNA analysis of a father and son with dominant fast channel congenital myasthenic syndrome revealed an AChR alpha-subunit F256L missense mutation affecting channel gating PMID: 15079006
A good correlation was found between the expression of PAX3/7-FKHR and AChR, while MyoD1 was more sensitive but less specific. PMID: 16435141
the interaction between alpha AChR M1 and M2 domains plays a key role in channel gating PMID: 17028140
growth factor-induced HMVEC migration, a key angiogenesis event, requires nAChR activation--an effect mediated in part by nAChR-dependent regulation of thioredoxin activity. PMID: 17082486
Here we describe a mechanism controlling thymic transcription of a prototypic tissue-restricted human auto-antigen gene, CHRNA1 PMID: 17687331
No CHRNA1, CHRNB1, or CHRND mutations were detected, but a homozygous RAPSN frameshift mutation, c.1177-1178delAA, was identified in a family with three children affected with lethal fetal akinesia sequence. PMID: 18179903
study reports homozygous nonsense mutations in CHRNA1 and CHRND and shows that they were lethal PMID: 18252226
Presence of heterogeneous nuclear ribonucleoprotein H-binding motif in CHRNA1 close to the 3' end of an intron is an essential but underestimated splicing regulator of the downstream exon. PMID: 18806275

Hide All

Involvement in disease

Multiple pterygium syndrome, lethal type (LMPS); Myasthenic syndrome, congenital, 1A, slow-channel (CMS1A); Myasthenic syndrome, congenital, 1B, fast-channel (CMS1B)

Subcellular Location

Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Protein Families

Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-1/CHRNA1 sub-subfamily

Tissue Specificity

Isoform 1 is only expressed in skeletal muscle. Isoform 2 is constitutively expressed in skeletal muscle, brain, heart, kidney, liver, lung and thymus.

Database Links

HGNC: 1955

OMIM: 100690

KEGG: hsa:1134

STRING: 9606.ENSP00000261007

UniGene: Hs.434479

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-EP005386HU
MSDS	MSDS
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP005386HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CHRNA1. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP005386HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CHRNA1.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Acetylcholine receptor subunit alpha (CHRNA1), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage