Recombinant Human Angiopoietin-like protein 8 (ANGPTL8)

In Stock
Code CSB-BP757793HU
Abbreviation Recombinant Human ANGPTL8 protein
MSDS
Size $472
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
ANGPTL8; C19orf80; RIFL; UNQ599/PRO1185Angiopoietin-like protein 8; Betatrophin; Lipasin; Refeeding-induced fat and liver protein
Species
Homo sapiens (Human)
Source
Baculovirus
Expression Region
22-198aa
Target Protein Sequence
APMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Hormone that acts as a blood lipid regulator by regulating serum triglyceride levels. May be involved in the metabolic transition between fasting and refeeding: required to direct fatty acids to adipose tissue for storage in the fed state.
Gene References into Functions
  1. ANGPTL8 levels are lower in Prader-Willi syndrome than obese controls and are inversely associated with the severity of liver steatosis. Further studies should investigate the potential genetic basis for this observation. PMID: 28600576
  2. Inhibition of miR-143-3p amplified ANGPTL8 response to treatments (glucose, insulin, Lipopolysaccharides), suggesting that the miRNA acts to suppress ANGPTL8 expression under metabolically distorted conditions. PMID: 30261196
  3. Study suggests that ANGPTL8 levels in early pregnancy are significantly and independently associated with risk of GDM at 24-28 weeks of gestation. PMID: 29167926
  4. Circulating full-length ANGPTL8 concentrations in patients with dyslipidemia were significantly elevated as compared to controls. PMID: 30021605
  5. ApoCIII may mediate the effects of ANGPTL8 on triglyceride metabolism. PMID: 30021607
  6. Study shows that angiopoietin-like protein 8 (ANGPTL-8) was positively correlated with hepatocellular lipid content independent of obesity and insulin resistance, indicating that ANGPTL-8 might be a new and important important predictor of the severity of non-alcoholic fatty liver disease. PMID: 29266821
  7. We conclude that serum betatrophin concentrations were increased in pregnancies affected by hyperemesis gravidarium. PMID: 29754072
  8. Data suggest the angiopoietin-like 8 (ANGPTL8)/p62-IKKgamma axis as a negative feedback loop that regulates NF-kappaB activation, and extends the role of selective autophagy in fine-tuned inflammatory responses. PMID: 29255244
  9. ANGPTL8 levels are increased in both plasma and adipose tissues of subjects with hypertension. PMID: 29490644
  10. Serum ANGPTL8 concentrations were significantly increased in impaired glucose regulation and type 2 diabetes. PMID: 29082263
  11. the level of circulating betatrophin is positively associated with insulin resistance. PMID: 28931172
  12. we identified ANGPTL8 as the target gene at this HDL-C GWAS locus, determined regulatory drivers of tissue specificity, and combined fine-mapping approaches and regulatory overlap with experimental assays to identify variants that may contribute to the HDL-C GWAS signal at ANGPTL8. PMID: 28754724
  13. serum levels not associated with weight status, glucose tolerance, insulin resistance, or lipid metabolism PMID: 27402552
  14. Elevated betatrophin levels in polycystic ovary syndrome women, in the absence of obesity and glucose intolerance, may reflect a compensatory mechanism in order to counteract metabolic syndrome-related risk factors. PMID: 28319674
  15. betatrophin levels appeared to be related to the pathogenesis of the diabetic stages rather than prediabetic stages. PMID: 28351091
  16. Angiopoietin-like protein 8/betatrophin is related to liver steatosis, while visceral adipose tissue represents an additional site of expression in humans. PMID: 28351093
  17. ANGPTL8 reverses established Adriamycin induced cardiomyopathy by stimulating adult cardiac progenitor cells. PMID: 27823982
  18. Study provided an update to understand its physiological function from literature curated findings through an integrated view of ANGPTL8's regulation and its associated pathways. PMID: 28684091
  19. betatrophin is increased in pancreatic cancer-associated diabetes PMID: 27276680
  20. These results confirm a role for ANGPTL8 in lipoprotein metabolism and provide novel support for functional consequences of the rs2278426 variant. PMID: 27117576
  21. ANGPTL8 has a functional LPL inhibitory motif, but only inhibits LPL and increases plasma TG levels in mice in the presence of ANGPTL3 PMID: 28413163
  22. The inflammation-induced miR-221-3p regulates ANGPTL8 expression in adipocytes. This miRNA impact may become especially prominent under pathologic conditions such as morbid obesity, putatively contributing to the impaired adipose tissue lipid metabolism in metabolic disease. PMID: 28938482
  23. Circulating ANGPTL8 increases after bariatric surgery and predicts type 2 diabetes remission in morbidly obese patients. PMID: 28347650
  24. Data suggest that plasma betatrophin levels are significantly increased in lean (normal-weight) women with PCOS (polycystic ovary syndrome) compared to lean women without PCOS; plasma betatrophin levels are not significantly altered in overweight/obese women with PCOS compared to overweight/obese women without PCOS. This study was conducted in China. PMID: 27960599
  25. Especially the association to eGFR highlights the importance for future studies to address renal function as possible influence on betatrophin regulation and consider eGFR as potential confounder when analyzing the role of betatrophin in humans PMID: 28257453
  26. Serum betatrophin is an independent risk factor for nonalcoholic fatty liver and potential non-invasive marker for its progression. PMID: 28125672
  27. Cord blood betatrophin may function as a potential biomarker of maternal intrauterine hyperglycemia and fetal insulin resistance, which may presage for long-term metabolic impact of gestational diabetes on offspring PMID: 27196053
  28. The high levels of ANGPTL8 found in fetal life together with its relationship with newborn adiposity and brown adipose tissue point to ANGPTL8 as a potential new player in the modulation of the thermogenic machinery during the fetal-neonatal transition. PMID: 27469268
  29. Betatrophin levels were increased in women with PCOS and were associated with insulin resistance, c-reactive protein, and free-testosterone in these patients. PMID: 26832343
  30. Obesity is associated with increased betatrophin suppression after an oral glucose load; this response appears to be driven by hyperglycemia. Data suggest that the impaired betatrophin response in obese subjects is restored after weight loss and is comparable with the betatrophin response in lean individuals. PMID: 27459526
  31. Serum betatrophin levels are increased and associated with insulin resistance in patients with polycystic ovary syndrome. PMID: 28222635
  32. ANGPTL8/betatrophin might play an important role in glucose metabolism in the context of insulin resistance. PMID: 26387753
  33. This study supports that serum betatrophin plays an important role in MetS, involving the regulations of glucose and lipid metabolism and inflammation. PMID: 27238790
  34. our data shows that ANGPTL3, 4 and 8 are increased in obesity and type 2 diabetes (T2D). ANGPTL8 associates with ANGPTL3 in the non-diabetic subjects while it associated more with ANGPTL4 in the obese and T2D subjects. PMID: 27733177
  35. circulating betatrophin is increased in mice and humans with NAFLD and its expression was induced by endoplasmic reticulum stress in hepatocytes PMID: 27045862
  36. High betatrophin expression is associated with diabetic metabolic syndrome. PMID: 27578619
  37. Elevated betatrophin levels were associated with cardiometabolic risk factors a young population, but the association was largely dependent on vitamin D status. PMID: 27716289
  38. betatrophin may be associated with thyroid insufficiency but not thyroid autoimmunity. PMID: 27213151
  39. Betatrophin levels in patients with polycystic ovary syndrome (PCOS) are lower than those without PCOS and inversely related to insulin resistance. PMID: 27188865
  40. data shows for the first time that heterozygote form of ANGPTL8 Rs.2278426 variant was associated with higher FBG level in Arabs highlighting the importance of these variants in controlling the function of betatrophin. PMID: 26864934
  41. Serum betatrophin concentrations are increased in type 2 diabetes patients under antidiabetic treatment and positively associated with diabetic retinopathy. PMID: 26863068
  42. Compared with type 2 diabetes without cardiovascular disease (CVD), patients with CVD had remarkably higher levels of angiopoietin-like protein 8 (ANGPTL8). PMID: 27596060
  43. Circulating betatrophin concentration is negatively correlated with insulin resistance in obese children and adolescents. PMID: 27103367
  44. Meta-analysis results from case control studies on betatrophin and type 2 diabetes (T2DM) revealed increased circulating levels of betatrophin in patients with T2DM. PMID: 27242389
  45. ANGPTL8 levels were associated with baseline and future changes in triglyceride levels in Korean children. PMID: 26739706
  46. Betatrophin is significantly increased in T2DM patients with different stages of albuminuria. Betatrophin may be a novel endocrine regulator involved in DN development. PMID: 26739836
  47. ANGPTL8 is increased in subjects with MetS and it was significantly associated with HsCRP levels in different subgroups. PMID: 26850725
  48. Disruption of ANGPTL8 function in humans does not seem to have a large effect on measures of glucose tolerance. PMID: 26822414
  49. Based on the findings of our meta-analysis, circulating betatrophin level of T2DM patients is higher than that of nondiabetic adults in the nonobese population, but not in the obese population. PMID: 26697500
  50. In patients with diabetes mellitus type 2, betatrophin levels did not correlate with beta-cell function-related variables or insulin resistance-related variables PMID: 26649318

Show More

Hide All

Involvement in disease
Diabetes mellitus, insulin-dependent (IDDM); Diabetes mellitus, non-insulin-dependent (NIDDM)
Subcellular Location
Secreted.
Protein Families
ANGPTL8 family
Tissue Specificity
Predominantly expressed in liver. Also expressed in adipose tissues.
Database Links

HGNC: 24933

OMIM: 125853

KEGG: hsa:55908

STRING: 9606.ENSP00000252453

UniGene: Hs.534467

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*