| Code | CSB-YP757793HU |
| MSDS | |
| Size | Pls inquire |
| Source | Yeast |
| Have Questions? | Leave a Message or Start an on-line Chat |
| Code | CSB-EP757793HU-B |
| MSDS | |
| Size | Pls inquire |
| Source | E.coli |
| Conjugate | Avi-tag Biotinylated E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag. |
| Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
We would like to know the protein concentration and cell strain of CSB-MP757793HU.
https://www.cusabio.com/Recombinant-Protein/Recombinant-Mouse-Hepatocellular-carcinoma-associated-protein-TD26-homologGm648-Mammalian-cell-12547434.html#a01
We are looking forward to hearing from you.
APMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA