Recombinant Human Angiotensinogen (AGT), partial

Code CSB-EP001463HU1
Abbreviation Recombinant Human AGT protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
Aangiotensinogen (serpin peptidase inhibitor clade A member 8); AGT; AI265500; Alpha 1 antiproteinase antitrypsin; Ang; Ang I; Ang II; Ang III; AngII; Angiotensin I; Angiotensin II; Angiotensin III; Angiotensin-3; Angiotensinogen (PAT); Angiotensinogen; ANGT_HUMAN; ANHU; ANRT; AT-2; AT-II; Des-Asp[1]-angiotensin II; FLJ92595; FLJ97926; MGC105326; PAT; Pre angiotensinogen; Serine (or cysteine) proteinase inhibitor; Serpin A8; Serpin peptidase inhibitor clade A member 8; SERPINA8
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
44-427aa
Target Protein Sequence
VIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLDFTELDVAAEKIDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEFWVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYASDLDKVEGLTFQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIRVGEVLNS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
57.9kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Essential component of the renin-angiotensin system (RAS), a potent regulator of blood pressure, body fluid and electrolyte homeostasis.; acts directly on vascular smooth muscle as a potent vasoconstrictor, affects cardiac contractility and heart rate through its action on the sympathetic nervous system, and alters renal sodium and water absorption through its ability to stimulate the zona glomerulosa cells of the adrenal cortex to synthesize and secrete aldosterone.; stimulates aldosterone release.; is a ligand for the G-protein coupled receptor MAS1. Has vasodilator and antidiuretic effects. Has an antithrombotic effect that involves MAS1-mediated release of nitric oxide from platelets.
Gene References into Functions
  1. Patients with heart failure and type 2 diabetes mellitus with AGT TT + MT genotype had a higher level of ST2 and a higher probability of unfavorable cardiovascular events during 24 months of observation compared with MM genotype carriers. PMID: 29578435
  2. Unfavorable genotype of polymorphic variants of candidate gene participating in endothelial dysfunction AGT (Thrl74Met and Met23SThr) was associated with changes in levels of their active substances in individuals exposed to mercury. PMID: 30351652
  3. Angiotensin 1-7 can modulate cell adhesion and epithelial-mesenchymal transition of normal prostate epithelial cells. PMID: 29802847
  4. These findings reveal the critical role of hypoxia in producing local angiotensin II by a lactate-chymase-dependent mechanism and highlight the importance of local angiotensin II in regulating radioresistance of hypoxic tumor cells. PMID: 28205588
  5. The reduced urinary AGT/creatinine in Autralian Indigenous pregnant women may reflect subclinical renal dysfunction which limits the ability of the kidney to maintain sodium balance and could indicate an increased risk of pregnancy complications and/or future renal disease. PMID: 29674190
  6. ACE2 and other enzymes can form ANG-(1-7) directly or indirectly from either the decapeptide ANG I or from ANG II. [review] PMID: 29351514
  7. The ACE and AGT gene polymorphisms are not associated with the progress of diabetes developing into retinopathy in Chinese patients with type 2 diabetes. PMID: 29378484
  8. AGT M235T and T174M variants contribute to an increased risk of developing preeclampsia (PE), and for M235T to PE severity. PMID: 29366364
  9. Data, including data using network analysis, suggest that angiotensinogen (AGT), mitogen-activated protein kinase-14 (MAPK14), and prothrombin (F2) in placental villous tissues are core factors in early embryonic development; these studies involved proteomics and bioinformatics analysis of altered protein expression in placental villous tissue from early recurrent miscarriage patients in comparison to control tissues. PMID: 29277264
  10. The AGT (M235T) gene polymorphism do not seem to have a significant effect on the development of clinical properties or cardiovascular comordities of acromegalic patients. PMID: 28712073
  11. Angiotensin II has a role in increasing glomerular permeability by beta-arrestin mediated nephrin endocytosis PMID: 28004760
  12. After donor nephrectomy, increasing uAGT levels can be the result of activation of the intrarenal renin-angiotensin system affecting the compensatory changes in the remaining kidney. PMID: 28988519
  13. M235T polymorphism of the AGT gene seems unrelated to the development or the clinical course of endometriosis. PMID: 29303211
  14. AGT missense polymorphisms are not associated with diabetic nephropathy in our subset of Slovenian type 2 diabetes mellitus patients PMID: 28488548
  15. Association of AGT single nucleotide polymorphism rs3789678 and gestational hypertension in Chinese population. PMID: 27910864
  16. Data suggest that angiotensin-II plays important role in development of albuminuria, particularly in subjects with impaired glucose metabolism; here, serum angiotensin-II levels are up-regulated in subjects with prediabetes and type 2 diabetes as compared to subjects with normal glucose metabolism; elevated serum angiotensin-II level may be early biomarker or risk factor for vasculitis. PMID: 28797632
  17. The T allele of AGT may play a role in the pathogenesis of preeclampsia in South African Black women. PMID: 28641212
  18. These data indicate that Ang II-AT2R regulates human bone marrow MSC migration by signaling through the FAK and RhoA/Cdc42 pathways. PMID: 28697804
  19. Data suggest that up-regulaton of Ang-(1-7) levels in follicular fluid correlates with increases in number of mature oocytes retrieved upon ovarian stimulation in preparation for in vitro fertilization. PMID: 28402544
  20. Urinary angiotensinogen and renin excretion are elevated in CKD patients. Both parameters are negatively associated with eGFR and these associations are independent of urinary albumin excretion PMID: 28395289
  21. Reduced IL-18 serum concentration in children after HUS with no difference in its urine concentration may indicate a loss of the protective effects of this cytokine on renal function due to previously occurred HUS. PMID: 27982687
  22. Angiotensin II initiates hepatocyte epithelial-mesenchymal transition by activating the NOX-derived H2O2-mediated NLRP3 inflammasome/IL-1ss/Smad circuit. PMID: 27445100
  23. angiotensin II induced abdominal aortic aneurysm growth and inflammation is attenuated by imatinib PMID: 27085160
  24. present study has demonstrated, for the first time, that high glucose augments AGT in human RPTCs through HNF-5, which provides a potential therapeutic target for diabetic nephropathy PMID: 29053707
  25. AngII-dependent phosphorylation of LCP1 in cultured podocytes was mediated by the kinases ERK, p90 ribosomal S6 kinase, PKA, or PKC. LCP1 phosphorylation increased filopodia formation. PMID: 28768720
  26. Autosomal dominant polycystic kidney disease (ADPKD), uniquely increases urinary angiotensinogen and renin excretion despite their circulating levels being comparable with those in non-ADPKD chronic kidney disease. PMID: 28747358
  27. Quaternary interactions and supercoiling modulate the cooperative DNA binding of AGT. PMID: 28575445
  28. results show that SNPs in the Hap-I of the hAGT gene promote high-fat diet-induced binding of transcription factors GR, CEBP-beta and STAT3, which lead to elevated expression of the hAGT gene in hepatic and adipose tissues PMID: 28467442
  29. Angiotensinogen import and subsequent trafficking to the mitochondria occurs in proximal kidney tubules. PMID: 27903492
  30. Transgenic mice expressing human AGT in the subfornical organ AGT and possibly ANG I/ANG II into the cerebral ventricles. PMID: 28490451
  31. AngII could induce pulmonary injury by triggering endothelial barrier injury, and such process may be related to the dephosphorylation of Y685-VE-cadherin and the endothelial skeletal rearrangement PMID: 28119542
  32. Renin-angiotensin system transgenic mouse model suggests that renal injury in preeclampsia may be mediated through local VEGF. PMID: 27927648
  33. endoplasmic reticulum stress induces apoptosis in human alveolar epithelial cells through mediation of unfolded protein response pathways, which in turn regulate the autocrine ANGII/ANG1-7 system. PMID: 27638906
  34. Angiotensin II stimulates PYY secretion, in turn inhibiting epithelial anion fluxes, thereby reducing net fluid secretion into the colonic lumen. PMID: 27447725
  35. NOXs had two time-dependent reactions in response to Ang II stimulation via MAPK pathwa PMID: 27807688
  36. increased Ang-II/Ang-(1-7) ratios may lead to Ang-II over-activation and aggravate atherosclerosis progression. PMID: 27432541
  37. urinary angiotensinogen could be a prognostic marker of the albuminuria reduction effects of olmesartan in patients with metabolic syndrome PMID: 27801805
  38. AGT expression is significantly upregulated in human masticatory mucosa during wound healing PMID: 28005267
  39. Urinary angiotensinogen reflects intrarenal RAS status, and is of value to assess the severity of acute tubular necrosis . PMID: 27788506
  40. Data suggest that enhanced survival of normal prostate epithelial cells (PNT1A cell line) in presence of either or both angiotensin II (Ang II) and relaxin 2 (RLN2) appears to be associated with increased ratio of BCL2/BAX messenger RNA expression; thus, Ang II and/or RLN2 appear to be involved in regulation of apoptosis in prostate epithelium. PMID: 27119161
  41. increasing the serum levels of AngII increased the risk of acute myocardial infarction (AMI); the risk of AMI increased when the serum levels of AngII and KLK1 simultaneously increased; individuals with the combined genotypes of ACE DD and KLK1 GG showed increased risk of AMI compared with those with the combined genotypes of ACE II and KLK1 AA PMID: 27329205
  42. genetic association study and meta-analysis revealed a significant association between M235T polymorphism of angiotensinogen and myocardial infarction risk PMID: 27586550
  43. significant association between Thr207Met polymorphism and chronic kidney disease progression in autosomal dominant polycystic kidney disease PMID: 26482465
  44. The aim of this work is to assess the influence of the rs1799752 polymorphism of the angiotensin-converting enzyme (ACE) gene and the rs699 polymorphism of the angiotensinogen (AGT) gene on the in-stent restenosis in Polish patients with stable coronary artery disease. PMID: 27162064
  45. in cultured H9C2 cells and that CyPA/CD147 signaling pathway inhibition protects against Ang II-induced cardiomyocyte hypertrophy. PMID: 27590243
  46. The circulating ACE2 and Ang-(1-7) levels were related to neither rs4646155 nor rs879922 in female or male patients.In conclusion, the rs2106809 polymorphism of the ACE2 gene may be a determinant of the circulating Ang-(1-7) level in female patients with hypertension, suggesting a genetic association between circulating Ang-(1-7) levels and ACE2 gene polymorphisms in patients with hypertension. PMID: 27310975
  47. observed significantly higher prevalence of ACE DD and AGTR1 1166CC genotypes in hypertrophic cardiomyopathy (HCM) and dilated cardiomyopathy (DCM) patients. Also, 235TT genotype of AGT (M235T) was significantly associated with enhanced risk of the disease phenotype in HCM, DCM, and RCM. PMID: 28120210
  48. Angiotensinogen expression is down regulated in human ileal Crohn's disease, particularly in the presence of inflammation and current cigarette smoking, implicating the mesenteric vasculature and mucosal hypoxia as co-factors in ileal CD pathogenesis. PMID: 27014752
  49. AGT M235T polymorphism was associated with SAH risk in Caucasian-Brazilians, and no association was detected with CAD PMID: 27019433
  50. Protective role of g.5855G>A polymorphism in the development of Essential Hypertension in Indian population was reported. The results reflect possibility of ethnic variation in contribution of g.5855G>A polymorphism of the AGT gene to the disease. PMID: 27398822

Show More

Hide All

Involvement in disease
Essential hypertension (EHT); Renal tubular dysgenesis (RTD)
Subcellular Location
Secreted.
Protein Families
Serpin family
Tissue Specificity
Expressed by the liver and secreted in plasma.
Database Links

HGNC: 333

OMIM: 106150

KEGG: hsa:183

STRING: 9606.ENSP00000355627

UniGene: Hs.19383

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*