Recombinant Human Aryl hydrocarbon receptor (AHR), partial

Code CSB-EP001481HU7
Abbreviation Recombinant Human AHR protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
Class E basic helix-loop-helix protein 76
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
27-80aa
Target Protein Sequence
PAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
13.1 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ligand-activated transcription factor that enables cells to adapt to changing conditions by sensing compounds from the environment, diet, microbiome and cellular metabolism, and which plays important roles in development, immunity and cancer. Upon ligand binding, translocates into the nucleus, where it heterodimerizes with ARNT and induces transcription by binding to xenobiotic response elements (XRE). Regulates a variety of biological processes, including angiogenesis, hematopoiesis, drug and lipid metabolism, cell motility and immune modulation. Xenobiotics can act as ligands: upon xenobiotic-binding, activates the expression of multiple phase I and II xenobiotic chemical metabolizing enzyme genes (such as the CYP1A1 gene). Mediates biochemical and toxic effects of halogenated aromatic hydrocarbons. Next to xenobiotics, natural ligands derived from plants, microbiota, and endogenous metabolism are potent AHR agonists. Tryptophan (Trp) derivatives constitute an important class of endogenous AHR ligands. Acts as a negative regulator of anti-tumor immunity: indoles and kynurenic acid generated by Trp catabolism act as ligand and activate AHR, thereby promoting AHR-driven cancer cell motility and suppressing adaptive immunity. Regulates the circadian clock by inhibiting the basal and circadian expression of the core circadian component PER1. Inhibits PER1 by repressing the CLOCK-ARNTL/BMAL1 heterodimer mediated transcriptional activation of PER1. The heterodimer ARNT:AHR binds to core DNA sequence 5'-TGCGTG-3' within the dioxin response element (DRE) of target gene promoters and activates their transcription.
Gene References into Functions
  1. Expression of microRNA potentially regulated by AhR and CAR in malignant tumors of the endometrium has been reported. PMID: 30225717
  2. The overexpression and activation of AHR are involved in the early development of skin squamous cell carcinomas. AHR expression correlates with EGFR expression and may influence cell proliferation. PMID: 30144817
  3. These studies identified SNPs that were cis-eQTLs for DEFB1 and AHR and, which were associated with variation in plasma KYN concentrations that were related to severity of major depressive disordersymptoms. PMID: 29317604
  4. rs2470893 SNP, which maps 196 bp from a CYP1A1 promoter XRE, is associated with variations in 3MC-dependent AHR binding and CYP1A1 expression. PMID: 29980579
  5. WASH-mediated AHR expression has a critical function in the maintenance of NKp46+ innate lymphoid cells PMID: 28589939
  6. the protective role of AhR in intestinal barrier function PMID: 29992488
  7. Elevated AhR expression may be involved in the progression of tissue remodeling in chronic rhinosinusitis without nasal polyp without allergic rhinitis similar to TGF-beta1 expression. Conversely, lower AhR expression may be involved in allergic reactions in chronic rhinosinusitis with nasal polyp with allergic rhinitis. PMID: 29183012
  8. These results suggest that D-Kyn increases lung cancer cells to metastasize by activating Ahr. PMID: 29442266
  9. The role of IDO1-IDO2-AHR pathway in the TLR4-induced tolerogenic phenotype in human dendritic cells has been reported. PMID: 28256612
  10. The association between AHR Arg55Lys polymorphism and male infertility risk was not confirmed (Meta-Analysis) PMID: 29427904
  11. A meta-analysis of five sets of data evaluated the association of aryl hydrocarbon receptor 1661G>A with male infertility. PMID: 28712079
  12. IDO decreased glycolysis and glutaminolysis by activating GCN2K, resulting in activation of AMPactivated protein kinase. PMID: 29693118
  13. AHR inhibition or knockdown/knockout consistently reduced human ER-/PR-/Her2- and inflammatory breast cancer cell invasion, migration, and metastasis. This was associated with a decrease in invasion-associated genes (e.g., Fibronectin, VCAM1, Thrombospondin, MMP1) and an increase in CDH1/E-cadherin, previously associated with decreased tumor aggression. PMID: 29735912
  14. This study demonstrated that the regulation of AHR expression by miR124 is critical to the development of inflammatory response in chronic rhinosinusitis with nasal polyps. PMID: 29605298
  15. In human keratinocytes, authors found that perillaldehyde (1) inhibited BaP-induced AHR activation and ROS production, (2) inhibited BaP/AHR-mediated release of the CCL2 chemokine, and (3) activated the NRF2/HO1 antioxidant pathway. PMID: 29643980
  16. Infants born to women with specific AHR and XRCC1 genotypes may have higher genetic risks for birth weight reduction PMID: 28893607
  17. ITE suppresses growth of human pulmonary artery endothelial cells independent of AhR PMID: 29140133
  18. High AHR expression is associated with nerve sheath tumorigenesis. PMID: 29351992
  19. IRES (ribosome entry site)activity is increased in the PTX-resistant ovarian cancer cells in which AHR protein expression was also enhanced. These results strongly suggest an important role for AHR ribosome entry site (IRES)-dependent translation mechanism in cancer cell response to paclitaxel treatment PMID: 29048649
  20. AhR activation by FICZ reduces FcepsilonRI and upregulates IDO expression in Langerhans cells. This AhR-mediated anti-inflammatory feedback mechanism may dampen the allergen-induced inflammation in atopic dermatitis. PMID: 28376268
  21. Report yeast estrogen screen for androgen- and estrogen-receptor mediated activities of 4-hydroxytestosterone, 4-hydroxyandrostenedione and their human metabolites. PMID: 29702199
  22. Report AhR-dependent transcriptional activity during acute exposure of lung cells to distinct types of environmental pollutants. PMID: 29704546
  23. The nuclear localization signal (NLS) is closed in the absence of a ligand, the structure of AhR will be changed in the presence of a ligand, which leads to NLS open, result in the nuclear translocation of AhR. PMID: 29092071
  24. Study provides evidence that AhR plays a critical role in polycyclic aromatic hydrocarbon-mediated DNA damage. PMID: 28886471
  25. in transcriptionally active heterodimer with ARNT, which recognizes the dioxin response element (DRE) in the promoter of downstream genes, right next to the DRE-docking sites is the extensive dimerization surface that is more hydrophobic than other surface areas, indicating that the dimerization interface of the AHR transcription complex is largely dictated by hydrophobic contacts PMID: 28396409
  26. AHR signaling is essential for activin A induced regulatory T cells that restrain asthmatic responses. PMID: 28320933
  27. Aryl hydrocarbon receptor activation induced by FICZ and Glyteer increased the expression of OVOL1 and Filaggrin in a dose- and time-dependent manner in normal human epidermal keratinocytes. PMID: 28703805
  28. Study shows the Q-rich/PST domain of the aryl hydrocarbon receptor regulates both ligand-induced nuclear transport and nucleocytoplasmic shuttling. PMID: 27535013
  29. Data suggest that response of bronchial epithelial cells to environmental carcinogen benzo[a]pyrene includes activation of AhR/Src/ERK signaling, CYP1A1 induction, and formation of stable DNA adducts. (AhR = aryl hydrocarbon receptor; Src = Src proto-oncogene kinase; ERK = extracellular signal-regulated kinases; CYP1A1 = cytochrome P450 family 1 subfamily A member 1) PMID: 29545172
  30. These data support a mechanistic pathway for the putative tumour suppressive role of AHR specifically in pituitary adenomas, possibly through its role as a cell cycle co-regulator, even in the absence of exogenous ligands. PMID: 28649092
  31. upregulation of mRNA and protein expression is associated with the pathogenesis of unexplained miscarriage PMID: 28503784
  32. The AhR physiological role in cancer [review] PMID: 28508231
  33. Our findings suggest that AhR-mediated IL-1beta regulation in cerebral endothelium could induce BBB breakdown and contribute to the pathogenesis of a variety of neurologic disorders. PMID: 28285151
  34. Ultraviolet B rays suppressed SIRT1 expression by activating AhR, and subsequently inhibited DNMT1 activity in CD4+ T cells from systemic lupus erythematosus patients. PMID: 28336124
  35. AHR regulated cell proliferation and tumorigenesis by directly targeting and activating HDAC8 expression in hepatocellular carcinoma cells. PMID: 27283490
  36. Human CCL1 gene is selectively targeted by AhR in M(IL-4) macrophage. IL-4-induced epigenetic modification potentiates AhR-mediated CCL1 expression. PMID: 27888289
  37. Moreover, time course and promoter activity assays suggest that TIPARP and TIPARP-AS1 work in concert to regulate AHR signaling. Collectively, these data show an added level of complexity in the AHR signaling cascade which involves lncRNAs, whose functions remain poorly understood. PMID: 29274782
  38. Utilising a three-dimensional lymph endothelial cell (LEC) monolayer & MDA-MB231 breast cancer cell spheroid co-culture model in combination with knock-down approach allowed elucidation of the molecular/biochemical basis of AHR/CYP1A1-induced tumour breaching through the LEC barrier. PMID: 28171546
  39. breast cancer ER status likely influences AhR activity involved in these signaling pathways. The mechanisms involved in AhR activation and target gene expression in breast cancers are also discussed PMID: 29320557
  40. AhR modulates hyperoxic lung injury by regulating the genes that are necessary for cell proliferation and inflammation. PMID: 27103661
  41. This study of human fibroblasts bearing endogenous heterozygous AIP mutations and transfected pituitary GH3 cells shows that AIP mutations affect the AIP protein level and alter AhR transcriptional activity in a gene- and tissue-dependent manner. PMID: 27080473
  42. We demonstrated that infants whose mothers smoked during pregnancy with the combination of AHR, CYP1A1, and XRCC1 polymorphisms had lower birth size. PMID: 27592400
  43. A low AHR-expression level in human lung cancer tissues is significantly associated with its malignancy.Cytoplasmic, resting AHR protein acts as an epithelial-mesenchymal transition suppressor via a non-genomic pathway. PMID: 27752740
  44. Aryl hydrocarbon receptor signaling modifies Toll-like receptor-regulated responses in human dendritic cells. PMID: 27783115
  45. These findings identify a role for pattern recognition receptor (PRR) signaling in regulating the AHR response through selective down-regulation of Cyp1 expression in human monocytes and macrophages. PMID: 29018148
  46. The results of the present study suggest that AhR stimulates estrogen-dependent progression of breast carcinoma by inducing aromatase expression under some conditions. These results provide new insights on the possible roles of environmental toxins in breast cancer development. PMID: 27900579
  47. AHR, CYP1A1, CYP1A2, or CYP1B1 variants associated with head-and-neck squamous cell carcinoma risk in smokers. PMID: 27894333
  48. Low AHR expression is associated with Prostate Cancer. PMID: 28972393
  49. activation of the aryl hydrocarbon receptor using the non-toxic agonist 2-(1'H-indole-3'-carbonyl)-thiazole-4-carboxylic acid methyl ester (ITE) induces human regulatory t cells. PMID: 27783946
  50. this study demonstrates a role for the AHR in regulating human B cell development, and it suggests that transcriptional alterations of EBF1 by the AHR are involved in the underlying mechanism PMID: 28978690

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus.
Tissue Specificity
Expressed in all tissues tested including blood, brain, heart, kidney, liver, lung, pancreas and skeletal muscle. Expressed in retinal photoreceptors.
Database Links

HGNC: 348

OMIM: 600253

KEGG: hsa:196

STRING: 9606.ENSP00000242057

UniGene: Hs.171189

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*