Recombinant Human Axin-2 (AXIN2), partial

In Stock Promotion
Code CSB-EP897472HU
Abbreviation Recombinant Human AXIN2 protein, partial
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
Axin-like protein;Axil;Axis inhibition protein 2;Conductin
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
745-843aa
Target Protein Sequence
EDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRMLKAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWEDETVLPMYEGRILGKVERID
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.4 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Inhibitor of the Wnt signaling pathway. Down-regulates beta-catenin. Probably facilitate the phosphorylation of beta-catenin and APC by GSK3B.
Gene References into Functions
  1. increased abundance of Snail and Axin2 is highly correlated to malignant transformation of OL, making them novel biomarker(s) predicting oral cancer development PMID: 28939076
  2. Review. Polymorphic variants in AXIN2 gene are discussed in relation to the occurrence of the tooth agenesis but also as an indication of the risk of cancer. Mutations in AXIN2 gene were found in patients with colorectal or hepatocellular carcinoma, prostate cancer, ovarian or lung cancer. PMID: 28759178
  3. Consistent with bioinformatics predictions, SOX7 was correlated positively with AXIN2 and negatively with beta-catenin, suggesting that SOX7 and AXIN2 might play important roles as co-regulators through the Wnt-beta-catenin pathway in the breast tissue to affect the carcinogenesis process. PMID: 27188720
  4. we performed an association study of AXIN2, BMP4 and IRF6 gene SNPs with Non-Syndromic Cleft Lip with or without Cleft Palate in an Iranian population and the findings proposed that BMP4 rs17563 polymorphism is associated with reduced risk against Non-Syndromic Cleft Lip with or without Cleft Palate. PMID: 29211286
  5. The results demonstrated miR-3120-5p promotes stemness and invasiveness of colon cancer cells through direct targeting of Axin2. PMID: 29307822
  6. Hepatic Axin2 expressing CD90+ cells play a cancer stem cell-like role in the progression from liver cirrhosis to hepatocarcinoma. PMID: 28783177
  7. AXIN2 overexpression is associated with Breast Cancer Invasion and Metastasis. PMID: 27197202
  8. the study reveals a strong association of SNPs in the Axin2 gene with lung cancer risk in North Indians. PMID: 28378643
  9. The genotype distribution of the rs1133683 polymorphism C> T showed a statistical difference between the two study groups ( p = 0.0019). individuals with either the C/T or T/T genotype have a decreased risk for colorectal cancer. For the rs2240308 polymorphism C > T, the OR analysis showed a significantly increased risk for carriers of the T/T genotype. PMID: 27228364
  10. Genetic variant in AXIN2 gene is associated with gallbladder cancer. PMID: 26715268
  11. Data show that SS18/SSX tightly regulates the elevated expression of the key Wnt target AXIN2 in primary synovial sarcoma. PMID: 26905812
  12. our mutation analysis detected already known mutations as well as, to the best of our knowledge, mutations and an interstitial deletion of CTNNB1 not described in JAs before. Additionally, a so far unknown transcribed Axin2 splice variant was found, but no further Axin2 mutations. PMID: 26572152
  13. miR-374a functions as an oncogene in osteosarcoma, and the miR-374a/Axin2 axis might represent a potential therapeutic target for OS intervention. PMID: 26617789
  14. Flow cytometrically sorted CA9+ population showed increased mRNA level of a Wnt signaling factor AXIN2. In conclusion, these observations indicate that CA9 expression in normal crypt base cells has association with intestinal epithelial stemness PMID: 26648507
  15. Increase in AXIN2 level expression is associated with breast cancer. PMID: 26514524
  16. rs9675316 located on chr17q23-a24 near the AXIN2 gene was the most significantly associated with hallux valgus in males in genome-wide association meta-analyses. PMID: 26337638
  17. Low AXIN2 was independently associated with more aggressive Prostate cancer , biochemical recurrence, and metastasis-free survival after Prostatectomies . PMID: 26771938
  18. Axin2, a tumor suppressor, exhibited a marked inhibitory effect on Eca109 cell growth. The results identified a new role of miR-374a in esophageal cancer involving Axin2 suppression PMID: 26252180
  19. study supports the relationship between AXIN2 mutation and non-syndromic oligodontia and extends the mutation spectrum of the AXIN2 gene. PMID: 26406231
  20. AXIN2 rs2240308 polymorphism significantly and race-specifically correlates with decreased cancer risk (Meta-Analysis) PMID: 25974148
  21. Suggest that miR-107 could promote HCC cell proliferation via targeting Axin2. PMID: 26191213
  22. Our data suggest the AXIN2 1989G>A mutation may not have solely a loss-of-function role in colorectal cancer PMID: 26025668
  23. Conductin shows reduced binding to Dvl2 compared to axin, and degradation of beta-catenin by conductin is only poorly blocked by Dvl2. PMID: 25380820
  24. borderline results gave hint that rs2240307 contributed to susceptibility to CPO in a Chinese Han population, which was conductive to improving awareness of the causes of NSOC. PMID: 24484320
  25. The Axin2 rs2240308 polymorphism is associated with susceptibility to lung cancer. PMID: 25091576
  26. Results suggest tha tthe pathological progression from Serrated adenoma through colon carcinoma required the successive events: mutations in BRAF protein, hypermethylation of MLH1 then hypermethylation in AXIN2. PMID: 24964857
  27. findings indicate that AXIN2 can be regarded as a candidate gene for mutation detection in individuals with non-syndromic oligodontia in the Chinese population. PMID: 24581859
  28. a novel missense AXIN2 variant was identified in an AFAP family with no signs of oligodontia and ectodermal dysplasia. PMID: 23838596
  29. MiR-205 is a novel anti-oncogenic miRNA in KB oral cancer cells via down-regulation of Axin-2. PMID: 24166197
  30. AXIN genes do not play a major role in adrenocortical carcinoma tumorigenesis and Wnt/beta-catenin signaling pathway activation. AXIN2 germline variant c2013_2024del12 is likely to be a non-pathogenic polymorphism. PMID: 23812285
  31. involvement of PAX9, EDA, SPRY2, SPRY4, and WNT10A as risk factors for MLIA. uncovered 3 strong synergistic interactions between MLIA liability and MSX1-TGFA, AXIN2-TGFA, and SPRY2-SPRY4 gene pairs. 1st evidence of sprouty genes in MLIA susceptibility. PMID: 24554542
  32. The generally increased expression of axin 2 in all tumor stages as compared to normal tissue suggests an initiating pathogenic function in the development of colorectal carcinoma. PMID: 23702820
  33. These findings suggest that nuclear AXIN2 functions as a rheostat to control MYC expression in response to Wnt/beta-catenin signaling. PMID: 24299953
  34. Axin2 regulates nuclear GSK-3 localization and Snail mediated E-cadherin promoter activity in colorectal cancer cells. PMID: 23624843
  35. rs3923086 in AXIN2 and rs3763511 in DKK4 that did not show any association in the overall population were significantly associated with early on-set and estrogen receptor negative breast cancers, respectively. PMID: 23516639
  36. CDX2 activated APC and AXIN2 promoter activities via intestinal cell-specific enhancer elements; results suggest that a low CDX2 level has influence on the Wnt signaling in invasive colon cancer cells possibly promoting cellular migration PMID: 23393221
  37. Borderline association with a decreased risk of cleft lip with or without cleft palate was observed for the AXIN2 rs3923087 variant. PMID: 22887353
  38. tooth agenesis had increased risk of a family history of cancer. tooth agenesis was associated with positive self-reported family history of cancer and variants in AXIN2. PMID: 23169889
  39. Axin2 acts as a potent promoter of carcinoma behavior by up-regulating the activity of the transcriptional repressor, Snail1, inducing a functional epithelial-mesenchymal transition (EMT) program and driving metastatic activity PMID: 22745173
  40. CDC20-mediated degradation of conductin regulates Wnt/beta-catenin signalling for maximal activity during G1/S. PMID: 22322943
  41. results continue to support a role for AXIN2 in the etiology of human clefting PMID: 22370446
  42. the AXIN2 Intron2 rs35285779 single nucleotide polymorphism (SNP) is associated with development of prostate cancer as a protective SNP PMID: 21069480
  43. AXIN2, a Wnt target gene, showed increased expression in all serous ovarian cancer samples. PMID: 21666490
  44. novel Axin 2 gene mutations may be a predisposing factor in ethnic Kashmiri population to colorectal cancer PMID: 21541676
  45. The present study reports, for the first time, that AXIN2 genetic defects may be found in adrenocortical tumors. PMID: 21733995
  46. a cohort of 93 Swedish probands with non-syndromic, isolated oligodontia, mutations were identified in the EDARADD), AXIN2, MSX1, and PAX9 genes PMID: 21626677
  47. The results of this study indicated that Axin2 is an essential regulator of remyelination and that it might serve as a pharmacological checkpoint in this process. PMID: 21706018
  48. Molecular analysis disclosed six distinct heterozygous AXIN2 variations in familial melanoma subjects. PMID: 21294210
  49. The data indicate that conductin regulate centrosomal cohesion by altering the phosphorylation status of beta-catenin at the centrosomes. PMID: 20300119
  50. AXIN2 has ben implicated int he mixed form of tooth agenesis. PMID: 19816326

Show More

Hide All

Involvement in disease
Colorectal cancer (CRC); Oligodontia-colorectal cancer syndrome (ODCRCS)
Subcellular Location
Cytoplasm.
Tissue Specificity
Expressed in brain and lymphoblast.
Database Links

HGNC: 904

OMIM: 114500

KEGG: hsa:8313

STRING: 9606.ENSP00000302625

UniGene: Hs.156527

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*