Recombinant Human BRCA1-associated protein (BRAP),Partial

Code CSB-EP773793HU(M)
Abbreviation Recombinant Human BRAP protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
(BRAP2)(Impedes mitogenic signal propagation)(IMP)(RING finger protein 52)(RING-type E3 ubiquitin transferase BRAP2)(Renal carcinoma antigen NY-REN-63)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-262aa
Target Protein Sequence
SVSLVVIRLELAEHSPVPAGFGFSAAAGEMSDEEIKKTTLASAVACLEGKSPGEKVAIIHQHLGRREMTDVIIETMKGGGGSGGGGSEIVHGIMHLYKTNKMTSLKEDVRRSAMLCILTVPAAMTSHDLMKFVAPFNEVIEQMKIIRDSTPNQYMVLIKFRAQADADSFYMTCNGRQFNSIEDDVCQLVYVERAEVLKSEDGASLPVMDLTELPLE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
24.5 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Negatively regulates MAP kinase activation by limiting the formation of Raf/MEK complexes probably by inactivation of the KSR1 scaffold protein. Also acts as a Ras responsive E3 ubiquitin ligase that, on activation of Ras, is modified by auto-polyubiquitination resulting in the release of inhibition of Raf/MEK complex formation. May also act as a cytoplasmic retention protein with a role in regulating nuclear transport.
Gene References into Functions
  1. Six polymorphisms (rs12229654 at 12q24.1, rs671 of ALDH2, rs11066015 of ACAD10, rs2074356 and rs11066280 of HECTD4, and rs3782886 of BRAP) were found to be associated with both systolic and diastolic blood pressure, with those at 12q24.1 or in ACAD10 or BRAP being novel determinants of blood pressure in Japanese. PMID: 28562329
  2. IMPACT data were consistent with increased risks of onset among BRCA1 and BRCA2 mutation carriers PMID: 27742670
  3. Expression of BRAP is increased in esophageal squamous cell carcinoma samples compared with non-tumor esophageal tissues; increased expression correlates with reduced patient survival time and promotes metastasis of xenograft tumors in mice. PMID: 28780075
  4. Together the results indicate for the first time that BRAP2 may play an important NRNI role in germ cells of the testis, with an additional, scaffold/structural role in mature spermatozoa. PMID: 25820252
  5. BRAP gene may confer vulnerability for schizophrenia in Han Chinese population. PMID: 24454952
  6. ectopic expression of BRAP2 inhibits nuclear localization of HMG20A and NuMA1, and prevents nuclear envelope accumulation of SYNE2. PMID: 23707952
  7. genetic association studies in population of Chinese Han young adults in Beijing: Data suggest that 2 SNPs in BRAP (rs11066001; rs3782886) are associated with decreased risk of metabolic syndrome in this population. PMID: 22965072
  8. BAP1 expression closely correlates with age, clinical stage, pathologic differentiation and histological type in colorectal cancer (CRC). BAP1 may serve as a novel prognostic biomarker for CRC. PMID: 23526420
  9. Brap2 regulates temporal control of NF-kappaB localization mediated by inflammatory response. PMID: 23554956
  10. The BRAP polymorphism may not play an important role in ischemic stroke in the Taiwanese population. PMID: 23356535
  11. The dominant effect of prolonged USP15 depletion upon signal amplitude is due to a decrease in CRAF levels while allowing for the possibility that USP15 may also function to dampen MAPK signaling through direct stabilization of BRAP. PMID: 23105109
  12. ANRIL on 9p21 and BRAP were both associated with ankle brachial index in a Taiwanese population. PMID: 22122968
  13. Several BRCA1 mutations were observed in Pakistani breast cancer patients with moderate family history. PMID: 22078348
  14. Data show that BRAP conferred a risk for carotid plaque and intima-medial thickness. PMID: 21670849
  15. BRAP gene is associated with the extent of coronary atherosclerosis and has a synergistic effect with diabetes on the occurrence of significant CAD in the Chinese population PMID: 22085839
  16. our approach, which is applicable to any set of interval scale traits that is heritable and exhibits evidence of phenotypic clustering, identified three new loci in or near APOC1, BRAP, and PLCG1, which were associated with multiple phenotype domains. PMID: 22022282
  17. Polymorphism of 270 A > G in BRAP is Associated with Lower Ankle-Brachial Index and peripheral artery disease. PMID: 21301165
  18. All results are consistent with BRAP2 being a novel, phosphorylation-regulated negative regulator of nuclear import, with potential as an antiviral agent. PMID: 20040518
  19. Data indicate that one SNP in BRAP showed(rs11066001) a significant association in allele frequency distribution with CAD in both the Japanese and Korean populations. PMID: 19713974
  20. modulates sensitivity of the MAP kinase cascade to stimulus-dependent activation by limiting functional assembly of the core enzymatic components through the inactivation of KSR PMID: 14724641
  21. Monocytic differentiation of the promyelomonocytic cell lines U937 and HL60 is associated with the upregulation of Brap2 expression concomitantly with the upregulation and cytoplasmic relocalization of p21. PMID: 15340083
  22. the capacity of IMP to inhibit signal propagation through Raf to MEK is a consequence of disrupting KSR1 homooligomerization and B-Raf/c-Raf hetero-oligomerization PMID: 18332145
  23. The most current evidence suggests that it may be more beneficial in those with BRCA mutations because tumors associated with these mutations are likely to be estrogen-receptor positive. PMID: 18380995
  24. p21 Ras/Imp regulate cytokine production and migration in CD4 T cells [Imp] PMID: 18577512
  25. Carriers of mutations in the genes BRCA1/2 may present a specific high risk group for PABC especially at younger ages. PMID: 19009954
  26. The authors found that Brap2, which has intrinsic RING domain dependent E3 ligase activity, facilitates HsCdc14A Lys-63 linked ubiquitin modification, indicating that Brap2 may be the ubiquitin E3 Ligase of HsCdc14A. PMID: 19152073
  27. SNPs in BRAP associated with risk of myocardial infarction in Asian populations.BRAP knockdown in cultured coronary endothelial cells suppressed activation of NF-kappaB. PMID: 19198608

Show More

Hide All

Subcellular Location
Cytoplasm.
Tissue Specificity
Expressed in breast epithelial cell lines.
Database Links

HGNC: 1099

OMIM: 604986

KEGG: hsa:8315

STRING: 9606.ENSP00000403524

UniGene: Hs.530940

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*