Recombinant Human Bromodomain-containing protein 2 (BRD2), partial

In Stock
Code CSB-EP002800HU1
Abbreviation Recombinant Human BRD2 protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
Really interesting new gene 3 protein
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
65-187aa
Target Protein Sequence
EVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQEL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.6 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May play a role in spermatogenesis or folliculogenesis. Binds hyperacetylated chromatin and plays a role in the regulation of transcription, probably by chromatin remodeling. Regulates transcription of the CCND1 gene. Plays a role in nucleosome assembly.
Gene References into Functions
  1. The results of the present study show evidence that BRD2 promoter methylation variation is a cause of juvenile myoclonic epilepsy in Caucasians PMID: 29608786
  2. acetylated peptide selectivity between human BET Brd2 bromodomains BD-I and BD-II in glioblastoma PMID: 29956673
  3. In pluripotent cells, Brd2-Brd4 occupy Nodal gene regulatory elements (NREs), but only Brd4 is required for pluripotency gene expression. Brd4 downregulation facilitates pluripotent exit and drives enhanced Brd2 NRE occupancy, thereby unveiling a specific function for Brd2 in differentiative Nodal-Smad2 signalling PMID: 28588073
  4. BRDs are overexpressed in castration-resistant prostate cancer and that ATAD2 and BRD2 have prognostic value. PMID: 28591577
  5. The bromodomain and extraterminal domain (BET) family consists of BRDT, BRD2, BRD3, and BRD4, each containing 2 bromodomains located N-terminal to extraterminal domain, which is located near C-terminus. Data suggest that 10 distinct acylations participate in binding of BET family proteins to histone 4 (oligopeptide fragments used here); C-terminal bromodomains do not cooperatively bind multiple acylation sites. PMID: 28945351
  6. The identification of RNF43 mutations in a distinct subset of intraductal papillary neoplasm of the bile ducts revealed a new molecular role in the pathogenesis of this disease PMID: 27864998
  7. LRP1B, BRD2 and CACNA1D are new candidate genes in fetal metabolic programming of newborns exposed to maternal hyperglycemia. PMID: 26586120
  8. This study implicates BET Brds as important regulators of IkappaB kinase/NF-kappaB-mediated synovial inflammation of RA and identifies BET proteins as novel therapeutic targets in inflammatory arthritis. PMID: 26324948
  9. An unexpected role for the bromodomain and extraterminal domain (BET) proteins BRD2 and BRD4 in maintaining oncogenic IKK activity in activated B-cell-like diffuse large B-cell lymphoma. PMID: 25049379
  10. BET proteins, particularly Brd2 and Brd4, may play a key role in the regulation of Nrf2-dependent antioxidant gene transcription and are hence an important target for augmenting antioxidant responses in oxidative stress-mediated diseases. PMID: 24733848
  11. The C-terminal domain of Brd2 is important for chromatin interaction and regulation of transcription and alternative splicing. PMID: 24048450
  12. A structural basis for BRD2/4-mediated host chromatin interaction and oligomer assembly of Kaposi sarcoma-associated herpesvirus and murine gammaherpesvirus LANA proteins. PMID: 24146614
  13. The SNP alleles in BRD2, Cx-36, and ME2 and microdeletions in 15q13.3, 15q11.2, and 16p13.11 also contribute risk to juvenile myoclonic epilepsy' PMID: 23756480
  14. BRD2, BRD3, and BRD4 interact with gammaretroviral INs and serve as cofactors for murine leukemia virus integration. PMID: 24049186
  15. our results identify BRD2 as a new Tat-independent suppressor of HIV transcription in latently infected cells and underscore the therapeutic potential of BET inhibitors in the reversal of HIV latency. PMID: 23255218
  16. Brd2 and Brd4 proteins mediatE the responses of LFs after growth factor stimulation and drivE the induction of lung fibrosis in mice in response to bleomycin challenge. PMID: 23115324
  17. Our study did not confirm the presence of the genetic variants previously found to link the BRD2 gene to the idiopathic form of photosensitive epilepsy. PMID: 22766109
  18. The bromodomain-containing gene BRD2 is regulated at transcription, splicing, and translation levels. PMID: 21608014
  19. The BRDT gene was not expressed in testicular tissue from patients with Sertoli cells only, whereas the other three genes of the BET family retained expression in all the sperm pathologies. PMID: 22035730
  20. the crystal structure of the second bromodomain of BRD2 (BRD2-BD2) in complex with the di-acetylated histone H4 tail (H4K5ac/K12ac) was shown. PMID: 20709061
  21. Data report the crystal structures of the N-terminal bromodomain of human BRD2 (BRD2-BD1; residues 74-194) in complex with each of three different Lys-12-acetylated histone H4 peptides. PMID: 20048151
  22. Studies indicate that KSHV LANA interacts with Brd2 and Brd4. PMID: 20036832
  23. no difference was observed in the allele and genotype frequencies of BRD2 between juvenile myoclonic epilepsy (JME) and controls PMID: 19953286
  24. immunoblot and immunoprecipitation experiments to identify proteins interacting with Fsrg1 and RING3 PMID: 12145330
  25. highly significant linkage disequilibrium between juvenile myoclonic epilepsy and a core haplotype of five single-nucleotide-polymorphism and microsatellite markers in chromosomal region 6p21 PMID: 12830434
  26. Evidence from transgenic mice suggests that Brd2 transactivates the cyclin A locus, and that overexpression increases cyclin A transcription, destabilizing the cell cycle. PMID: 16512664
  27. Present results support evidence that photoparoxysmal response and Myoclonic Epilepsy, Juvenile share epileptogenic pathways, for which BRD2 might be an underlying susceptibility gene. PMID: 16516380
  28. The results showed that BRD7 could interact with BRD2 and the region from amino acid 430 to 798 of BRD2 was critical for the interaction of BRD2 with BRD7. BRD2 mainly localizes in nucleus and BRD2 has distinct roles in initiating apoptosis. PMID: 16786191
  29. there are distinct functional roles for the two bromodomain proteins RING3/Brd2 and Brd4 in LANA binding PMID: 16940503
  30. Two acetyllysine-binding pockets and a negatively charged secondary binding pocket, produced at the dimer interface in BRD2 bromodomain 1 (BD1), may be the unique features that allow BRD2 BD1 to selectively bind to the acetylated histone H4 tail. PMID: 17148447
  31. Brd2 bromodomain 2 is monomeric in solution and dynamically interacts with H4-AcK12; additional secondary elements in the long ZA loop may be a common characteristic of BET bromodomains. PMID: 17848202
  32. study investigated the SNP markers (rs188254, rs206781, and rs516535) in the 3'-end of the BRD2 and found no significant difference between the allele frequencies in epilepsy cases and controls PMID: 17999746
  33. Results report that the double bromodomain proteins Brd2 and Brd3 associate preferentially in vivo with hyperacetylated chromatin along the entire lengths of transcribed genes. PMID: 18406326
  34. Brd2 is a novel protein kinase that plays a role in cell cycle-responsive transcription, recruiting E2F1, TATA Box Binding Protein and histone acetylase activity to E2F-responsive promoters in response to mitogenic stimuli. PMID: 17111193
  35. Brd2 associates with the transcription factor E2F, the Mediator components CDK8 and TRAP220, RNA polymerase II on chromatin; and associates with acetylated histone H4 through its bromodomains. PMID: 17148447
  36. The second bromodomain of Brd2 binds histone H4 acetyl-lysine K12. PMID: 17848202
  37. The BRD2 gene is located within the human class II major histocompatibility complex at Chromosome 6p21.3, but appears to have no role in antigen processing, and is likely involved in signal transduction and transcription. PMID: 11983150
  38. The BRD2 gene is homologous to the mammalian cell cycle regulator TAFII250 and the Drosophila trithorax group gene female sterile homeotic; the gene encodes a nuclear-localized kinase with signal transduction activity. PMID: 8595877
  39. Brd2-driven B cell lymphomas exhibit a transcriptional signature of diffuse large B cell lymphoma, and show differential expression of genes involved in normal proliferation, as well as several novel, tumor-specific genes. PMID: 17166848
  40. Brd2, a nuclear-localized protein kinase, binds to cyclin A promoter chromatin and recruits histone H4-specific acetylase activity, increasing cyclin A transcription and accelerating S phase entry in fibroblasts. PMID: 15548137
  41. B cell-restricted expression of Brd2 in transgenic mice upregulates cyclin A trancription even in mitogenically unstimulated B cells and causes lymphoma with a B1a-like immunophenotype, accompanied by peripheral B cell leukemia. PMID: 14563639
  42. Mitogenic stimuli induce nuclear localization of Brd2 protein. PMID: 10934046
  43. Brd2 protein participates in a nuclear complex that contains E2Fs. Overexpression of Brd2 protein with oncogenic ras transactivates E2F-dependent promoters of the cell cycle regulatory genes dihydrofolate reductase, cyclin D1, cyclin A and cyclin E. PMID: 10965846

Show More

Hide All

Subcellular Location
Nucleus. Note=Detected on chromatin and nucleosomes.
Database Links

HGNC: 1103

OMIM: 601540

KEGG: hsa:6046

STRING: 9606.ENSP00000378702

UniGene: Hs.734797

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*