Recombinant Human C-C motif chemokine 22 (CCL22), partial

Code CSB-RP058944h
Abbreviation Recombinant Human CCL22 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
A 152E5.1; ABCD 1; ABCD1; C C motif chemokine 22; CC chemokine STCP 1; CC chemokine STCP-1; ccl 22; Ccl22; CCL22_HUMAN; Chemokine (C C motif) ligand 22; DC/B CK; DCBCK; Macrophage-derived chemokine; MDC; MDC(1-69); MDC(7-69); MGC34554; SCYA22; Small inducible cytokine subfamily A (Cys Cys) member 22; Small inducible cytokine subfamily A; member 22; Small-inducible cytokine A22; STCP 1; STCP1; Stimulated T cell chemotactic protein 1 ; Stimulated T-cell chemotactic protein 1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
25-82aa
Target Protein Sequence
GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
33.7kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May play a role in the trafficking of activated/effector T-lymphocytes to inflammatory sites and other aspects of activated T-lymphocyte physiology. Chemotactic for monocytes, dendritic cells and natural killer cells. Mild chemoattractant for primary activated T-lymphocytes and a potent chemoattractant for chronically activated T-lymphocytes but has no chemoattractant activity for neutrophils, eosinophils, and resting T-lymphocytes. Binds to CCR4. Processed forms MDC(3-69), MDC(5-69) and MDC(7-69) seem not be active.
Gene References into Functions
  1. MDC might serve as a marker of pharmacological therapy response in major depressive disorder PMID: 28898872
  2. blood CCL22 levels were positively associated with IgE sensitization at age 2. A high cord blood CCL22/CXCL10 chemokine ratio was significantly associated with a higher risk of allergic sensitization at age 3. PMID: 27863395
  3. Tumor-associated macrophages promote prostate cancer migration through activation of the CCL22-CCR4 signaling axis. PMID: 28039457
  4. Elevations in serum MDC and BLC were independently associated with the significant risk of early stage lung adenocarcinoma, even in non-smokers and in stage IA patients. PMID: 27811371
  5. CCL22 plays an important role in supporting gastric cancer development presumably by increasing the percentage of regulatory T cells in the tumor microenvironments. CCL22 levels in sera have a predictive value for gastric cancer peritoneal metastasis and the early recurrence. PMID: 28501127
  6. The CCL22-mediated enhancement of antitumor responses is however not due to conversion, but rather to redirection of existing regulatory T cells to the site of cutaneous overexpression. PMID: 27634754
  7. CCL22 and IL-37 with a co-localization in non-small cell lung cancer A549 cells inhibited the proliferation and epithelial-mesenchymal transition process PMID: 27499437
  8. Our results demonstrate that CCL22 is expressed in human placenta. Decidual expression was only observed in miscarriage conditions and correlates with Treg infiltration. PMID: 25922986
  9. Distinctive Treg associated CCR4-CCL22 expression profile with altered frequency of Th17/Treg cell in the immunopathogenesis of Pemphigus Vulgaris. PMID: 26093920
  10. type I IFN blocks the regulatory T cell-attracting chemokine CCL22 and thus helps limit the recruitment of regulatory T cells to tumors PMID: 26432403
  11. First-episode psychosis patients had higher serum CCL22, which decreased substantially following antipsychotic treatment. PMID: 25970596
  12. Elevated levels of CCL22 found in the ascites could create a chemokine gradient aiding in Treg cells migration. Increased Tregs percentage in the local microenvironment of ovarian cancer might be an important mechanism of immunosuppression. PMID: 25647263
  13. Circulating CCL22 levels are related to both glioma risk and survival duration independent of age, histology, grade and IDH mutation status. CCL22 should be considered a marker of immune status with potential prognostic value PMID: 25604093
  14. CCL22 is a novel mediator of lung inflammation following hemorrhage and resuscitation PMID: 25136780
  15. CCR4 C1014T and CCL22 C16A genetic variations were neither associated with the risk, nor with the progression of colorectal cancer in Iranian population PMID: 25148803
  16. The serum CCL22 levels were affected by genetic variations at SNP rs223818. Accordingly, SNP rs223818 may play a role in the susceptibility to breast cancer. PMID: 25722218
  17. Sesamin suppressed lipopolysaccharide induced CCL22 expression in monocytes through the ER/PPAR-a, the MAPK-p38 pathway, the NFkB-p65 pathway and the epigenetic regulation by suppressing histone H3/H4 acetylation in the CCL22 promoter region. PMID: 25117529
  18. CCL22 could be an immune marker in ANCA-associated vasculitis. PMID: 25352172
  19. Suggest that lower CCL22 levels may play an important role in the pathogenesis of multiple sclerosis in women. PMID: 24254331
  20. CCL22 is an antimicrobial protein with bacteriocidal activity against E. coli and S. aureus. PMID: 12949249
  21. genetic polymorphism is not associated with breast carcinoma in Southern Iranian population PMID: 23268288
  22. both CCL22 and TGF-beta1 are candidate chemoattractants for intratumoral Foxp3 (+)Tregs infiltration; however, unlike the later, CCL22 is an independent prognostic predictor of BC patients. PMID: 24124553
  23. Autistic children had significantly higher serum levels of MDC than healthy controls PMID: 23782855
  24. Data suggest that decreased levels of plasmatic CCL22 may contribute to CD4(+) lymphopaenia. PMID: 23265706
  25. lymph node metastasis of CCR4(+) HNSCC is promoted by CCL22 in an autocrine or M2-like macrophage-dependent paracrine manner. PMID: 23180648
  26. High cord blood levels of the Th2 related chemokine CCL22 were significantly associated with high total- IgE levels during the first 6 years of life, but not with specific sensitization, asthma, eczema or allergic rhinitis. PMID: 23106659
  27. findings suggest that HBV infection and activity of the TGF-beta-miR-34a-CCL22 axis serve as potent etiological factors to predispose hepatocellular carcinoma patients for the development of portal vein tumor thrombus PMID: 22975373
  28. results suggested that suppression of the CCL22 gene using Salmonella induced anti-inflammatory effects PMID: 21823987
  29. Data suggest that variants of C-C motif chemokine 22 (CCL22) play a role in susceptibility to atopic dermatitis (AD) in a gain-of-function manner. PMID: 22125604
  30. chemokine CCL22 may have a role in abdominal aortic aneurysm PMID: 20348247
  31. CCL22 may be responsible for the infiltration of CD4(+)CD25(high) T cells into the pleural space of patients with tuberculous pleurisy. PMID: 20337996
  32. Plasma concentration of CCL22 correlates with the frequency of circulating CD4-positive FoxP3-positive (CD4+FoxP3+) regulatory T cells (Tregs) in human T-lymphotropic virus (HTLV) type 1-infected subjects. PMID: 20525891
  33. Endocrine disrupting chemicals suppressed CCL22 and IP-10 levels in cultured monocytes via, at least in part, the MKK1/2-ERK MAPK pathway and histone H4 acetylation. PMID: 19756997
  34. Data show that MDC/CCL22 is present in the synovial membrane of rheumatoid arthritis (RA) and psoriatic arthritis (PsA) patients and in synovial fluid of patients with RA and PsA, which would enable migration of CCR4 expressing memory cells. PMID: 19942450
  35. Chronic lymphocytic leukemia B cells are endowed with the capacity to attract CD4+, CD40L+ T cells by producing CCL22, suggesting a vicious circle, leading to the progressive accumulation of the neoplastic cells. PMID: 11981828
  36. Neither MDC release nor MDC mRNA was detected in any of the 3 types of fibroblasts stimulated with any of the cytokines examined. PMID: 12642832
  37. Serum levels of TARC and MDC in atopic dermatitis patients were significantly higher than those found in normal controls. PMID: 15113590
  38. CCL22 induced accumulation of phosphatidylinositol-(3,4,5)-trisphosphate in the leukemic T cell line CEM. CCL22 also had the ability to chemoattract human Th2 cells and CEM cells in a pertussis toxin-sensitive manner. PMID: 15187160
  39. CCL17 and CCL22, which are constitutively produced by immature DCs, mediate both T cell polarization and attraction. PMID: 15210758
  40. Elevated bronchial mucosal expression of MDC/CCL22 is implicated in asthma pathogenesis; its action is partly through selective development and retention, or recruitment of T helper type 2, not Th1, receptor-bearing cells. PMID: 15944327
  41. MDC/CCL22 has a role in inhibiting progression of lung cancer PMID: 16453150
  42. These data suggest that the CCL22 level produced by monocyte derived dendritic cells thus reflects the disease activity of Atopic dermatitis (AD) and it may also play an important role regarding the production of CCL22 in the pathogenesis of AD. PMID: 17008059
  43. A trend towards a decreased allelic frequency of the A allele of the CCL22 C/A SNP as well as of the T allele of the CCL17 C/T SNP was found in MS patients compared with controls. PMID: 17967467
  44. HTLV-1-infected T cells produce CCL22 through Tax and selectively interact with CCR4+CD4+ T cells, resulting in preferential transmission of HTLV-1 to CCR4+CD4+ T cells. PMID: 18178833
  45. MDC/CCL22 is likely to play a role in the development of multiple sclerosis in females only, possibly influencing the intracerebral recruitment of Th2 cells, which produce anti-inflammatory cytokines PMID: 18208895
  46. Significantly higher CCL22 expression is associated with gastric cancer PMID: 18224687
  47. although IE86 does repress the UL144-mediated activation of a synthetic NFkB promoter, it is unable to block UL144-mediated activation of the CCL22 promoter, and this lack of responsiveness to IE86 appears to be regulated by binding of CREB. PMID: 18287226
  48. serum CCR4 ligands (CCL17 and CCL22)may be useful inflammatory markers for assessing atopic dermatitis severity in children PMID: 18435706
  49. Development of allergic disease is associated with a more marked Th2-like deviation already at birth, shown as increased levels of cord blood IgE and MDC (CCL22) and higher ratios of MDC (CCL22) to IP-10 (CXCL10) and I-TAC (CXCL11). PMID: 19175890
  50. Regulatory T cells recruited through CCL22/CCR4 are selectively activated in lymphoid infiltrates surrounding primary breast tumors and lead to an adverse clinical outcome. PMID: 19244125

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Intercrine beta (chemokine CC) family
Tissue Specificity
Highly expressed in macrophage and in monocyte-derived dendritic cells, and thymus. Also found in lymph node, appendix, activated monocytes, resting and activated macrophages. Lower expression in lung and spleen. Very weak expression in small intestine. I
Database Links

HGNC: 10621

OMIM: 602957

KEGG: hsa:6367

STRING: 9606.ENSP00000219235

UniGene: Hs.534347

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*