Code | CSB-MP618996HU |
Size | $428 |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
The CD226 was produced as a fusion protein with a C-terminal hFc-Myc-tag in mammalian cells. Its expression region corresponds to the amino acid 19-247 of the human CD226 antigen. This recombinant CD226 protein is an active protein and its activity has been validated through the FACS assay. In the FACS assay, this human CD226 protein can bind to 293F cell overexpressing human CD155. The purity of this CD226 protein is greater than 93% measured by SDS-PAGE. On the gel, this CD226 protein migrated to the molecular weight band of about 66 kDa. It contains less endotoxin, <1.0 EU/ug determined by the LAL method. And it is available now. CD226, an activation receptor on NK cells and T cells, is involved in the function of CTL cells and NK cells. As an adhesion molecule, CD226 facilitates the migration, activation, proliferation, differentiation, and function of CD8+ T cells. |
Purity | Greater than 93% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | FACS assay shows that Human CD226 can bind to 293F cell overexpressing human CD155. |
Target Names | CD226 |
Uniprot No. | Q15762 |
Alternative Names | (DNAM-1)(DNAM1) |
Molecular Characterization | |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 19-247aa |
Target Protein Sequence | EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN |
Mol. Weight | 56.1 |
Protein Length | Partial |
Tag Info |
C-terminal hFc-Myc-tagged |
Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Involved in intercellular adhesion, lymphocyte signaling, cytotoxicity and lymphokine secretion mediated by cytotoxic T-lymphocyte (CTL) and NK cell. Cell surface receptor for NECTIN2. Upon ligand binding, stimulates T-cell proliferation and cytokine production, including that of IL2, IL5, IL10, IL13, and IFNG. Competes with PVRIG for NECTIN2-binding.
|
Gene References into Functions |
|
Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
Tissue Specificity | Expressed by peripheral blood T-lymphocytes. |
Database Links |
HGNC: 16961 OMIM: 605397 KEGG: hsa:10666 STRING: 9606.ENSP00000280200 UniGene: Hs.660130 |