Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
FACS assay shows that Human CD226 can bind to 293F cell overexpressing human CD155.
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
19-247aa
Target Protein Sequence
EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN
Tag Info
C-terminal hFc-Myc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The CD226 was produced as a fusion protein with a C-terminal hFc-Myc-tag in mammalian cells. Its expression region corresponds to the amino acid 19-247 of the human CD226 antigen. This recombinant CD226 protein is an active protein and its activity has been validated through the FACS assay. In the FACS assay, this human CD226 protein can bind to 293F cell overexpressing human CD155. The purity of this CD226 protein is greater than 90% measured by SDS-PAGE. On the gel, this CD226 protein migrated to the molecular weight band of about 66 kDa. It contains less endotoxin, <1.0 EU/ug as determined by the LAL method. And it is available now.
CD226, an activation receptor on NK cells and T cells, is involved in the function of CTL cells and NK cells. As an adhesion molecule, CD226 facilitates the migration, activation, proliferation, differentiation, and function of CD8+ T cells.