Recombinant Human CD226 antigen (CD226), partial (Active)

In Stock
Code CSB-MP618996HU
MSDS
Size $228
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    FACS assay shows that Human CD226 can bind to 293F cell overexpressing human CD155. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
FACS assay shows that Human CD226 can bind to 293F cell overexpressing human CD155.
Target Names
CD226
Uniprot No.
Alternative Names
(DNAM-1)(DNAM1)
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
19-247aa
Target Protein Sequence
EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN
Mol. Weight
56.1
Protein Length
Partial
Tag Info
C-terminal hFc-Myc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The CD226 was produced as a fusion protein with a C-terminal hFc-Myc-tag in mammalian cells. Its expression region corresponds to the amino acid 19-247 of the human CD226 antigen. This recombinant CD226 protein is an active protein and its activity has been validated through the FACS assay. In the FACS assay, this human CD226 protein can bind to 293F cell overexpressing human CD155. The purity of this CD226 protein is greater than 90% measured by SDS-PAGE. On the gel, this CD226 protein migrated to the molecular weight band of about 66 kDa. It contains less endotoxin, <1.0 EU/ug as determined by the LAL method. And it is available now.

CD226, an activation receptor on NK cells and T cells, is involved in the function of CTL cells and NK cells. As an adhesion molecule, CD226 facilitates the migration, activation, proliferation, differentiation, and function of CD8+ T cells.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in intercellular adhesion, lymphocyte signaling, cytotoxicity and lymphokine secretion mediated by cytotoxic T-lymphocyte (CTL) and NK cell. Cell surface receptor for NECTIN2. Upon ligand binding, stimulates T-cell proliferation and cytokine production, including that of IL2, IL5, IL10, IL13, and IFNG. Competes with PVRIG for NECTIN2-binding.
Gene References into Functions
  1. this paper shows that the decreased expression of activating receptor DNAM-1 on peripheral blood NK cells is positively associated with gastric cancer progression PMID: 30255106
  2. T allele and TT genotype of the CD226 rs763361 polymorphism is associated with susceptibility to type 1 diabetes and with a lower age of disease onset among Egyptian children PMID: 30145014
  3. These findings highlight the importance of the TIGIT/CD226/PVR axis as an immune checkpoint barrier that could hinder future "cure" strategies requiring potent HIV-specific CD8(+) T cells PMID: 28084312
  4. Sole engagement of NKG2D, 2B4 or DNAM-1 is insufficient for NF-kappaB activation. PMID: 27221592
  5. The Serum level of CD226 and not CD226 genotypes could be considered as an independent risk factor for the prediction of RA within healthy individuals and also for RA disease activity. PMID: 29319370
  6. Natural killer cells and cytotoxic T cells express both TIGIT and DNAM-1 receptors, and in certain cases their effector functions are dictated by TIGIT or DNAM-1 signaling. Agonist and antagonist antibodies targeting either TIGIT or DNAM-1 present many therapeutic options for diseases spanning from cancer to auto-immunity. (Review) PMID: 28035916
  7. Results indicate that low-grade inflammation coupled with elevated blood glucose increases CD226 expression, resulting in decreased endothelial cell glucose uptake in T2DM. PMID: 26910838
  8. Results show that CD226 expression was down-regulated in human hepatocellular carcinoma (HCC) cells. MiR-892a directly targeted CD226 promoting HCC cells proliferation and invasion. PMID: 27883251
  9. cumulative incidences of acute graft-versus-host disease in patients with high maximal serum levels of sDNAM-1 (>/=30 pM) in the 7 days before allogeneic hematopoietic stem cell transplantation were significantly higher than those in patients with low maximal serum levels of sDNAM-1 in the same period. Our data suggest sDNAM-1 is potentially a unique candidate as a predictive biomarker for the development of acute GVHD. PMID: 27257974
  10. Our results support an important association of rs4810485 in CD40 gene and rs763361 in CD226 gene polymorphism, combined effect of rs4810485 and rs763361 with increased risk of systemic lupus erythematosus. PMID: 27722794
  11. our results support and explain the mechanism behind the recently reported finding that in EOC, NK-cell recognition and killing of tumor cells was mainly dependent on DNAM-1 signaling while the contribution of the NKG2D receptor-ligand pathway was complementary and uncertain. PMID: 26563374
  12. CD226 rs763361 polymorphism was significantly associated with susceptibility to T1D. PMID: 26634488
  13. Age and CMV serostatus influence the expression of NKp30, NKp46 and DNAM-1 activating receptors on resting and IL-2 activated natural killer cells. PMID: 25991472
  14. we propose that expression of DNAM-1 on inflammatory monocytes are evolutionally conserved and act as an adhesion molecule on blood inflammatory monocytes. PMID: 26675069
  15. DNAM-1 ligands CD112 and CD155 as well as the NKG2D ligands MICA and MICB were expressed on the hiPSC lines PMID: 25950680
  16. The CD226 gene has been identified as novel association with JIA, and a SNP near CD28 as a suggestive association. PMID: 25057181
  17. Effector and regulatory CD4+ memory T cells of healthy individuals carrying the predisposing CD226 variant showed, in comparison to carriers of the protective variant, reduced surface expression of CD226 and impaired induction of CD226 after stimulation. PMID: 26359290
  18. The present study provides evidence that regulation of the PVR/CD155 DNAM-1 ligand expression by nitric oxide may represent an additional immune-mediated mechanism and supports the anti-myeloma activity of nitric oxide donors. PMID: 25609078
  19. our data reveal the existence of a functional program of NK cell maturation marked by DNAM-1 expression. PMID: 25818301
  20. genetic polymorphism is associated with rheumatoid arthritis, meta-analysis PMID: 25645050
  21. upregulated CD226 expression on CD8(+) T cells reflects disease severity and is involved in Systemic sclerosis pathogenesis via the production of various cytokines, including profibrotic IL-13 and endothelial cell injury PMID: 26109642
  22. NKG2D and DNAM-1 ligand upregulation might sensitize B cells undergoing lytic Epstein-Barr virus replication to NK cell recognition. (Review) PMID: 25597312
  23. Human regulatory T cells expressing the receptors TIGIT and CD226 display widely divergent phenotypes in regard to expansion and activation. PMID: 25994968
  24. Data show that leucocyte function-associated antigen-1 (integrin alphaLbeta2), DNAX accessory molecule-1 (DNAM-1) or tumour necrosis factor-related apoptosis-inducing ligand (TRAIL) enhance osteoclast survival when co-cultured with activated NK cells. PMID: 25684021
  25. NKG2D and DNAM-1 receptor-ligand interactions were essential in cytolysis by resting NK cells, as simultaneous blocking of both pathways resulted in almost complete abrogation of the cytotoxicity. PMID: 25854581
  26. the coordinated expression of LFA-1 and DNAM-1 is a central component of NK cell education and provides a potential mechanism for controlling cytotoxicity by functionally mature NK cells. PMID: 25825444
  27. Downregulated NKG2D, NKp46, and DNAM-1 receptors associated with impaired NK cell effector function are important biomarkers of advanced disease with a poor prognosis in melanoma patients. PMID: 24769842
  28. CD112 downregulation resulted in a reduced ability of DNAM-1 to bind to the surface of both virus-infected and gD-transfected cells. PMID: 25352670
  29. These findings indicated that functional polymorphism rs727088A>G in CD226 might modify the susceptibility for the development of Gastric cancer. PMID: 25510399
  30. Up-regulation of DNAM-1 and NKp30, associated with improvement of NK cells activation after long-term culture of mononuclear cells from patients with ovarian neoplasms. PMID: 24882570
  31. Findings suggest that TIGIT is a key checkpoint inhibitor of chronic antiviral and antitumor responses through impairing CD226 function when disrupting its homodimerization. PMID: 25465800
  32. UPR decreases CD226 ligand CD155 expression and sensitivity to NK cell-mediated cytotoxicity in hepatoma cells. PMID: 25209846
  33. rs763361 variant of CD226 gene (TT genotype) is associated with susceptibility to type 1 diabetes, greater frequency of GAD65 autoantibody, and with the degree of aggressiveness of the disease in T1D patients from Brazil PMID: 24891767
  34. Balance between activating NKG2D, DNAM-1, NKp44 and NKp46 and inhibitory CD94/NKG2A receptors determine natural killer degranulation towards rheumatoid arthritis synovial fibroblasts. PMID: 24673109
  35. CD226 rs763361, but not rs727088, gene polymorphism increased the risk of rheumatoid arthritis in a sample of the Iranian population. PMID: 23999715
  36. these results show that CD226 functions in immune synapse formation via its first extracellular domain. PMID: 24451371
  37. XLP1 inhibitory effect by 2B4 does not affect DNAM-1 and NKG2D activating pathways in NK cells. PMID: 24496997
  38. The CD226/CD155 interaction regulates the proinflammatory (Th1/Th17)/anti-inflammatory (Th2) balance in humans. PMID: 23980210
  39. While prior studies have found CD226 polymorphisms to be significantly associated with inflammatory demyelinating diseases, our results indicate the CD226 polymorphisms to be not associated with the diseases in Korean population. PMID: 23922043
  40. Overexpression of DNAM-1 was detected in the skin of patients with SSc (systemic sclerosis) PMID: 23161903
  41. CD226 Gly307Ser (rs763361) is significantly associated with the risk of multiple autoimmune diseases. PMID: 23073294
  42. A CD226 three-variant haplotype is related with genetic predisposition to systemic sclerosis-related pulmonary fibrosis. PMID: 22531499
  43. The G allele and GG genotype of rs727088 polymorphism in CD226 gene contributes to increased Cervical Squamous Cell Carcinoma susceptibility in a Han Chinese population. PMID: 23262348
  44. This demonstrates the CD226 rs763361 polymorphism confers susceptibility to autoimmune disease in Europeans, South Americans and Asians PMID: 22941566
  45. Demonstrate a genetic association between the CD226 gene and rheumatoid arthritis in a Chinese Han population with a potentially greater genetic effect than in the European population. PMID: 21286723
  46. CD226 gene polymorphisms may not be associated with rheumatoid arthritis susceptibility. PMID: 22302395
  47. CD226 polymorphisms, rs727088, rs34794968 and rs763361 were not involved in giant cell arteritis susceptibility in the Spanish population. PMID: 22512842
  48. A soluble nectin-2 immunoglobulin-like V-set domain (nectin-2v) has been successfully prepared and demonstrates binding to both soluble ectodomain and cell surface-expressed full-length DNAX accessory molecule (DNAM)-1. PMID: 22547693
  49. TIGIT can inhibit T cell functions by competing with CD226 and can also directly inhibit T cells in a T cell-intrinsic manner. PMID: 22427644
  50. Data indicate that NK cells from acute myeloid leukemia (AML) patients younger than 65 years have a reduced expression of DNAM-1 compared with age-matched controls. PMID: 21383766

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed by peripheral blood T-lymphocytes.
Database Links

HGNC: 16961

OMIM: 605397

KEGG: hsa:10666

STRING: 9606.ENSP00000280200

UniGene: Hs.660130

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*