Code | CSB-MP004941HU |
Size | $428 |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
Human CD48 amino acid Gln27-Ser220 with an N-terminal linker, a TEV (tobacco etch virus)+linker, and a C-terminal human IgG1 Fc tag (Pro100-Lys330), was expressed in mammalian cells. The resulting product is the recombinant human CD48 antigen. The purity of this CD48 protein reaches up to 91% detected by SDS-PAGE. This protein ran at a molecular weight of about 60 kDa by SDS-PAGE due to glycosylation. Its endotoxin content is less than 1.0 EU/ug determined by the LAL method. The bioactivity of this recombinant CD48 protein was measured in a functional ELISA. This CD48 protein can bind to the CD48 antibody with an EC50 constant of 0.5806-0.8463 ng/ml. And it is available now. CD48 is a glycosylphosphatidylinositol-anchored protein mainly expressed on hematopoietic cells as membrane-associated and soluble forms. Through interaction with its ligands such as CD2 and CD244, CD48 is involved in adhesion and activation of immune cells, modulation of target cell lysis by cytolytic cells, and detection of microbes through the CD48-Fimh interaction. CD48 is upregulated under inflammatory conditions and some hematologic malignancies. |
Purity | Greater than 91% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | Measured by its binding ability in a functional ELISA. Immobilized CD48 at 2 μg/ml can bind Anti-CD48 rabbit monoclonal antibody, the EC50 of human CD48 protein is 0.5806-0.8463 ng/ml. |
Target Names | CD48 |
Uniprot No. | P09326 |
Research Area | Cancer |
Alternative Names | B-lymphocyte activation marker BLAST-1 (BCM1 surface antigen) (Leukocyte antigen MEM-102) (SLAM family member 2) (SLAMF2) (Signaling lymphocytic activation molecule 2) (TCT.1) (CD48) (BCM1) (BLAST1) |
Molecular Characterization | |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 27-220aa |
Target Protein Sequence | QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS |
Mol. Weight | 51.3 kDa |
Protein Length | Full Length of Mature Protein |
Tag Info |
C-terminal hFc-tagged |
Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Ligand for CD2. Might facilitate interaction between activated lymphocytes. Probably involved in regulating T-cell activation.
|
Gene References into Functions |
|
Subcellular Location | Cell membrane; Lipid-anchor, GPI-anchor. |
Database Links |
HGNC: 1683 OMIM: 109530 KEGG: hsa:962 STRING: 9606.ENSP00000357025 UniGene: Hs.243564 |